SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000006852 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000006852
Domain Number 1 Region: 161-355
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.38e-59
Family Astacin 0.0000888
Further Details:      
 
Domain Number 2 Region: 627-737
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.54e-37
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 
Domain Number 3 Region: 787-894
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.42e-37
Family Spermadhesin, CUB domain 0.00018
Further Details:      
 
Domain Number 4 Region: 471-580
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-36
Family Spermadhesin, CUB domain 0.00026
Further Details:      
 
Domain Number 5 Region: 362-471
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-35
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 6 Region: 918-1011
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-29
Family Spermadhesin, CUB domain 0.00044
Further Details:      
 
Domain Number 7 Region: 735-779
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000576
Family EGF-type module 0.011
Further Details:      
 
Domain Number 8 Region: 582-624
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000984
Family EGF-type module 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000006852   Gene: ENSLAFG00000008166   Transcript: ENSLAFT00000008168
Sequence length 1022
Comment pep:novel supercontig:loxAfr3:scaffold_10:21593130:21756300:1 gene:ENSLAFG00000008166 transcript:ENSLAFT00000008168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRATALGALGPLLLPPMLLLLLLPLPRGAEGFGERSDAASDYWTPEDEEGAEQQLEHYH
DPCKAAVFWGDIALDEDDLKLFHIDKARDWAKQPMEKMEPSTGGLEEQPSESWPNTTAMN
TSSEEAKKDGKENTTLPQSPGTLNAVAETFSHRVRRATTSRTERIWPGGVIPYVIGGNFT
GSQRAIFKQAMRHWEKHTCVTFIERTEEESFIVFSYRTCGCCSYVGRRGGGPQAISIGKN
CDKFGIVAHELGHVVGFWHEHTRPDRDQHVTIIRENIQPGQEYNFLKMEAGEVSSLGETY
DFDSIMHYARNTFSRGVFLDTILPRRDDNGVRPTIGQRVRLSQGDIAQARKLYKCPACGE
TLQDTTGNFSAPGFPNGYPSYSHCVWRISVTPGEKIILNFTSMDLFKSRLCWYDYVEVRD
GYWRKAPLLGRFCGDKVPEPLISTDSRLWVEFRSSSNILGKGFFAEYEATCGGDINKDAG
QIQSPNYPDDYRPSKECVWRITVSEGFHVGLTFQAFEIERHDSCAYDYLEIRDGLTEEST
LIGHFCGYEKPEDVKSSSNRMWMKFVSDGSINKAGFAANFFKEVDECSWPDHGGCEQRCV
NTLGSYKCACDPGYELKADKKACEVACGGFISKLNGTITSPGWPKEYPTNKNCVWQVVAP
VQYRISLQFEVFELEGNDVCKYDFVEVRSGLSQDARLHGKFCGSETPDVITSQSNNMRVE
FKSDNTVSKRGFRAHFFSDKDECATDNGGCQHECVNTFGSYLCRCRNGYRLHENGLDCKE
AGCEHRLSSAEGTLASPNWPDKYPSRRECTWNISSTAGHRVKLTFNEFEIEQHQECAYDH
LEMYDGPDSLAPILGRFCGSKKPAPVVASSSSLFLRFHSDASVQRKGFQAVHSTECGGRL
KAEVQTKELYSHAQFGDNNYPSQARCDWVIVAEDGYGVELIFRTFEVEEEADCGYDYMEA
YDGYDSTAPRLGRFCGSWPLEEIYSAGDSLMIRFHTDDTINKKGFHARYTSTKFQDALHM
KK
Download sequence
Identical sequences G3T1C0
XP_003409259.1.64505 ENSLAFP00000006852 ENSLAFP00000006852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]