SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000006881 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000006881
Domain Number 1 Region: 70-175
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-35
Family Second domain of FERM 0.0000489
Further Details:      
 
Domain Number 2 Region: 173-318
Classification Level Classification E-value
Superfamily PH domain-like 3.2e-28
Family Third domain of FERM 0.00083
Further Details:      
 
Domain Number 3 Region: 2-69
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-17
Family First domain of FERM 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000006881   Gene: ENSLAFG00000008200   Transcript: ENSLAFT00000008201
Sequence length 653
Comment pep:novel supercontig:loxAfr3:scaffold_1:26206645:26399528:-1 gene:ENSLAFG00000008200 transcript:ENSLAFT00000008201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQKSTKGSVVLDHVFRHINLVEIDYFGLRYCDRSHQTYWLDPAKTLAEHKELINTGPPYT
LYFGIKFYAEDPCKLKEEITRYQFFLQVKQDVLQGRLPSPINVAAQLGAYAIQSELGDYD
PYKHTAGYVSEYRFVPDQKEELEEAIERIHKTLMGQAPSEAELNYLRTAKSLEMYGVDLH
PVYGENKSEYFLGLTPVGVVVYKNKKQVGKYFWPRITKVHFKETQFELRVLGKDCNETSF
FFEARSKTACKNLWCSVEHHTFFRYANLKSSVGSTLHARLYFLSFRSRLHGRTALQMSRD
LSIQLPRPDQNVARSRSKTYPKRIAPTQPAGSNSINRLTTNMENGENEGTTKIIAPSPVK
SFKKAKNENSPDTQRSKSHAPWEENGPQSGLYNSPSDRNKSPKFPYTRRRNPSCGSDNDS
LQPMRRRKAHNSGEDSDLKQRRRSRSRCNTSSGSESENSNREHRKKRNRIRPENDMVDSA
PQWEAVLRRQKEKNQADPNNRRSRHRSRSRSPDIQAKEELWHIQRELVDPSGLSEEQLKE
IPYTKIETQGDPIRIRHSHSPRSYRQYRRSQCSDGERSVLSEVNSKTDLVPPLPVTRSSD
AQGSGGSTVHQRRNGSKDSLIEEKSQTSTSNLAGKHTAKTIKTVQASRLKIET
Download sequence
Identical sequences G3T1E1
ENSLAFP00000006881 ENSLAFP00000006881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]