SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000006888 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSLAFP00000006888
Domain Number - Region: 48-101,142-173
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0067
Family Second domain of FERM 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000006888   Gene: ENSLAFG00000008207   Transcript: ENSLAFT00000008208
Sequence length 225
Comment pep:novel supercontig:loxAfr3:scaffold_31:24289577:24291319:-1 gene:ENSLAFG00000008207 transcript:ENSLAFT00000008208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLVADVLTRFENLAAEEAGLEDSLDSGWRLCLRLQGPLHPEGLSTDGHELPFLFEQAHAL
LHDTLRALAALRLQGLHRDFSLRAPLPRLDRLLPPPAPPREDPPRPAPRPPPSTALLAGA
LWSPGLAKRRAAAGITAREGGGGAGTAAAVLGGWKRLRGMGRAEAMAAYLALAAQCPGFG
AARSLVGVLHRSYAWAWEPRPCPSPDLVRQSPSTVSAMAMWPPAS
Download sequence
Identical sequences G3T1E5
ENSLAFP00000006888 ENSLAFP00000006888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]