SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000006979 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000006979
Domain Number 1 Region: 34-144
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.64e-31
Family Spermadhesin, CUB domain 0.00061
Further Details:      
 
Domain Number 2 Region: 245-357
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-26
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 3 Region: 437-475
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000017
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 4 Region: 151-187
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 5 Region: 199-241
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 6 Region: 398-436
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000272
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 7 Region: 361-398
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000072
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000006979   Gene: ENSLAFG00000008324   Transcript: ENSLAFT00000008324
Sequence length 847
Comment pep:novel supercontig:loxAfr3:scaffold_8:51144887:51183500:-1 gene:ENSLAFG00000008324 transcript:ENSLAFT00000008324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFWKLVYSLCLILGNGPLAEHSETVHISGVSTACGETPEQIRAPSGIITSPGWPSEYPAK
INCSWFIRANPGEIITISFQDFDIQGSRRCSLDWLTIETYKNIESYRACGSTIPPPYISS
QDHVWIRFHSDDNISRKGFRLAYFSGKSEEPNCACDQFRCGNGKCIPEAWKCNNMDECGD
SSDEEICAKEANSPTAAAFQPCAYNQFQCLSRFTKVYTCLPESLKCDGNIDCLDLGDEID
CDVPSCGQSLKYFYGTFNSPNYPDFYPPGSNCTWLIDTGDHRKVILRFTDFKLDGTGYGD
YVKIYDGLEENPHKLLRVLTAFDSHAPLTVVSSSGQIRVHFCADKVNAARGFNATYQVDG
FCLPWEIPCGGNWGCYTEQQRCDGYWHCPNGRDEINCTMCQKEEFPCSRNGVCYPRSDRC
NYQNHCPNGSDEKNCFFCQPGNFHCKNNRCVFESWVCDSQDDCGDGSDEENCPVIVPTRV
ITAAVIGSLICGLLLVIALGCTCKLYSLRMFERRSFETQLSRVEAELLRREAPPSYGQLI
AQGLIPPVEDFPVCSPNQASVLENLRLAVRSQLGFTSIRLPMAGRSSNIWNRIFNFARSR
HSGSLALVSADGDEVVPTQGTSREPERNSSHRSLFSVDPDDTDTENERRETAGASGGVAA
PLPQKVPPTTAVEATVAACGSSSTQSTRGGNTDNGRDVTSVEPPSVSPARHQLTSALSRM
TQGLRWVRFTLGRSSSINQNQSPLRQLDNGVNGREEDDDVEMLIPVSDGASDFDVNDCSR
PLLDLASDQGQGFRQPFSATNPGVRPSNRGDGLCEHCGIVHTAQIPDTCLEATLKNETSD
DEALLLC
Download sequence
Identical sequences G3T1L2
ENSLAFP00000006979 ENSLAFP00000006979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]