SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000007214 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000007214
Domain Number 1 Region: 598-662,700-798
Classification Level Classification E-value
Superfamily PH domain-like 4.2e-31
Family Pleckstrin-homology domain (PH domain) 0.0081
Further Details:      
 
Domain Number 2 Region: 804-922
Classification Level Classification E-value
Superfamily PH domain-like 1.34e-19
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Domain Number 3 Region: 1217-1349
Classification Level Classification E-value
Superfamily Second domain of FERM 8.9e-19
Family Second domain of FERM 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000007214
Domain Number - Region: 1118-1197
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000379
Family First domain of FERM 0.074
Further Details:      
 
Domain Number - Region: 29-120,705-725
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000753
Family BAR domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000007214   Gene: ENSLAFG00000008584   Transcript: ENSLAFT00000008590
Sequence length 1493
Comment pep:novel supercontig:loxAfr3:scaffold_40:18423009:18560620:1 gene:ENSLAFG00000008584 transcript:ENSLAFT00000008590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELSEPEGPVDWKERCVALESQLMKFRVQASKIRELLAEKMQQLERQVIDAERQAEKAF
QQVQVMEEKLKAANIQTSESETRLYRKCQDLETLIQEKDDIIQNLELQLEEQKQIRIQEA
KIIEEKAAKIKEWVTVKLNELELENQNLRVINQNQTEEIRTMQSKLQEVQGKKSSTVSTP
KLSEGQRLSSLTFGCFSSRARSPPQVIKSAEVSKLSSKEPEFTEGKDREGMEIPEKSGDN
QVQENSRGQRTLHQIPCGSEQSQKARASFATDGSMSQNSGAPASDWSSDEEEGSRGRPKS
RCRSTLSSHTSEEGVQCSRMGSETYLTASDDSSSVFEEETFSIKISEHKKLYSWQQEAQW
KAQNNPLGKGNSESKKKEQDSSSDELNKKFQSQRLDYSSSSSEANTPSPILTPALTPKHP
NLLPGKGTRLMSSSNLPPPKLRIPNVFSISVALAKRHLSQPQLSSDRMFGTNRNAISMIR
PLRPQETDLDLVDGDSTEVLENMDTSCDDGLFSYDSLGSPCSDDQETCDLAKKAACSKPP
TPPLHRFPSWESRIYAVAKSGIRMSEAFNMENANKNSVAMLSYTTSGLYTSLIYKNMTTP
VYTTLKGKATQISSSPFLDDSSGSEEEDSSRSSSRTSESDTRSRSGPGSPRAMKRGVSLS
SVASESDYAIPPDAYSTDTEHSQPEQKLPKTCSSSSDNGKNEPLEKSGYLLKMSGKVKTW
KRRWFVLKGGELLYYKSPSDVIRKPQGHIELSASCSILRGDNKQTVQLTTEKHTYYLTAD
SPNILEEWIKVLQNVLRVQATNPLFLQPEGKPTVKGLLTKVKHGYSKRVWCTLIGKTLYY
FRSQEDKFPLGQIKLWEAKVEEVDRSCDSDEDYEASGRSLLSTHYTIVIHPKDQGPTYLL
IGSKHEKDTWLYHLTVAAGSNNVNVGSEFEQLVCKLLNIEGEPSSQIWRHPTLCHSKEGI
ISPLTTLPSEALQTEAIKLFKTCQLFINAAVDSPAIDYHISLAQSALQICLTHPELQNEI
CCQLIKQTRRRQPQNQPGPLQGWQLLALCVGLFLPHHPFLWLLRLHLKRNADSRTEFGKY
AIYCQRCVERTQQNGDREARPSRMEILSTLLRNPYHHSLPFSIPVHFMNGIYQVVGFDAS
TTVEEFLNTLNQDTGMRKPALSGFALFTDDPSGRDLEHCLQGNIKICDIISKWEQASKEQ
QPGKCEGTRTVRLTYKSRLYFSVQARGETDREKLLLMYQTNNQIINGLFPLNKDLALEMA
ALLAQVEIGDFERPFSTPAGHITNQCKVNQTLKQVIEKFYPKRYRDGCSEEQLRQLCQRL
STRWMALRGHSTVDCVRIYLTVARKWPFFGAKLFLAKPITPSSLGNTFMWLAIHEDGLSI
LEYNSMRLIVSYVYKSLMTFGGYQDDFMVVINNMHSKDKPTEKLLFAMAKPKILEITLLI
ASYINNFHQQKAAFHHLSAPASLSARTRGPQAKAMGSQPLLSSSRPTKGPTLL
Download sequence
Identical sequences G3T246
ENSLAFP00000007214 ENSLAFP00000007214 XP_003416147.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]