SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000007378 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000007378
Domain Number 1 Region: 12-125
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.83e-43
Family Pyk2-associated protein beta ARF-GAP domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000007378   Gene: ENSLAFG00000008783   Transcript: ENSLAFT00000008783
Sequence length 430
Comment pep:novel supercontig:loxAfr3:scaffold_34:19703964:19758192:1 gene:ENSLAFG00000008783 transcript:ENSLAFT00000008783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGKSVKDVDRYQAVLANLLLEEDNKFCADCQSKGPRWASWNIGVFICIRCAGIHRNLGV
HISRVKSVNLDQWTQEQIQCMQEMGNGKANRLYEAYLPETFRRPQIDLAVEGFIRDKYEK
KKYMDRSLDINAFRKEKDDKWKRGSEPAPEKKMEPVVFEKVKMPQKKEDPQLPRKSSPKS
TAPVMDLLGLDAPVACSIANSKTSNTLEKDLDLLASVPSPSSSVSRKVVGSMPTAGSAGS
VPENLNLFPEPGSKSEETGKKQLSKDSILSLYGSQTPQMPAQAMFMAPAQMAYPTAYPTF
PGVTPPNSIMGSMMPPPVGMVTQPGASGMVAAPMAMPAGYMGGMQASMMGVPNGMMTTQQ
AGYMAGLAAMPQTMYGVQPAQQLQWNLTQMTQQMAGMNFYGANGMMNYGQSMNGGNGQAA
NQTLSPQMWK
Download sequence
Identical sequences G3T2I1
XP_003415575.1.64505 ENSLAFP00000007378 ENSLAFP00000007378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]