SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000007640 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000007640
Domain Number 1 Region: 590-851
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.64e-91
Family Eukaryotic proteases 0.0000000211
Further Details:      
 
Domain Number 2 Region: 336-443
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-28
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 3 Region: 224-329
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-19
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 
Domain Number 4 Region: 84-168
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000484
Family SEA domain 0.009
Further Details:      
 
Domain Number 5 Region: 449-485
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000236
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 522-557
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000445
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 7 Region: 485-522
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000838
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 8 Region: 561-601
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000757
Family LDL receptor-like module 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000007640   Gene: ENSLAFG00000009113   Transcript: ENSLAFT00000009113
Sequence length 852
Comment pep:novel supercontig:loxAfr3:scaffold_50:9635155:9665251:-1 gene:ENSLAFG00000009113 transcript:ENSLAFT00000009113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGHNFPQSPGWESQDHGLKGHTQKENMNGFEEGVEFLPVNNAKKVEKPGRRCWLVLAAVV
TGFFLLSLVGVLVWHFQYRDVRVQKVFNGHLRIKNENFVDAYENSNSTEFAHLANKVKEA
LKLLYSGIPALGPYHKDSAVTAFSEGSVIAYYWSEFSVPQHLVEEAERAMAEEHVVTLPP
RSRALQSMVLTSVVAFPTDPRTVQKTQDNSCSFALHARGREPTRFATPGFPDSPYPERAH
CQWALRGDANLVLSLTFRSFDLAPCDQRGSDLVTVYDSLSPIEPSAVVQLCGTYPPSYNL
TFLSSQNVFLVTLITNTERRHPGFEATFFQLPKMSSCGGYLRQAQGTFSSPYYPGHYPPN
IDCTWNIEVPNKQYVKVRFKLFYLVEPNVSPVTCSKDYVEVNGEKHCGEKSQFVVTSNSS
KMTVRFHSDQSYTDTGFLAEYLSYDSRDPCPGMFTCNTGRCIRKALRCDGWADCTDHSDE
LNCVCNATHQFTCKNKFCKPLFWVCDSVNDCGDNSDEQGCSCPAQTFRCNNGKCLPLSQQ
CDGTDHCGDGSDEATCDKVSTVTCTEHTYRCHNGLCVSKGNPECDGKEDCSDGSDEKDCD
CGQRSFSKQSRVVGGQNADEGEWPWQVSLHALGQGHVCGASLISPTWLVSAAHCHVDDKG
FRYSDPTLWTAFLGLHDQSKRRAPGVQEHKLKRIIRHPNFNDYTYDYDLALLELEQPAEY
SSLVRPICLPDATHVFPAGKAIWVTGWGHTQEGGSAAVILQKGEIRVINQTTCEKLLPQQ
LTARMMCVGYLSGGVDSCQGDSGGPLSSVEADGRIFQAGVVSWGEGCARRDKPGVYTRLS
MFRDWIKEQTGV
Download sequence
Identical sequences G3T345
ENSLAFP00000007640 ENSLAFP00000007640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]