SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000007663 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000007663
Domain Number 1 Region: 91-129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000134
Family Cripto EGF-like domain-like 0.00048
Further Details:      
 
Domain Number 2 Region: 55-89
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000402
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000007663   Gene: ENSLAFG00000009140   Transcript: ENSLAFT00000009140
Sequence length 160
Comment pep:novel supercontig:loxAfr3:scaffold_12:20912087:20915494:-1 gene:ENSLAFG00000009140 transcript:ENSLAFT00000009140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MECFSSSVIFIMAFSKAFELGLVAGGDADIRSQEEPVVRHQPFQFVPFMGIQDSKELNKT
CCLNGGTCMLGSFCACPPYFYGRNCEHDVRKENCGSVPHDTWLPRKCSMCKCWHGWLRCF
PQTFLPGCDGRVMDEHLEASRTPELLPSVCTTLMLASLCL
Download sequence
Identical sequences G3T368
ENSLAFP00000007663 ENSLAFP00000007663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]