SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000007682 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000007682
Domain Number 1 Region: 233-415
Classification Level Classification E-value
Superfamily vWA-like 0.00000000618
Family Integrin A (or I) domain 0.042
Further Details:      
 
Domain Number 2 Region: 721-829
Classification Level Classification E-value
Superfamily Sensory domain-like 0.00000785
Family YkuI C-terminal domain-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000007682   Gene: ENSLAFG00000009161   Transcript: ENSLAFT00000009165
Sequence length 1281
Comment pep:novel supercontig:loxAfr3:scaffold_17:29494603:29787399:-1 gene:ENSLAFG00000009161 transcript:ENSLAFT00000009165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAREPEEEETAGTTALIRCCRARRPPFWLLCLVVCWLPGALGDADFSILDEAQVLASQMR
RLAAEELGVVTMQRIFNSFVYTEKISNGESEVQQLAKKIREKFNRYLDVVNRNKQVVEAS
YTAHLTSPLTAIQDCCTIPPSMMEFDGNFNTNVSRTISCDRLSNTVNSRAFNPGRDLNSV
LADNLKSNPGIKWQYFSSEEGIFTVFPAHKFRCKGSYEHRSRPIYVSTVRPQSKHIVVIL
DHGASVTDTQLQIAKDAAQVILSAIDEHDKISVLTVADTVRTCSLDQCYKTFLSPATSET
KRKMSTFVSNVKSSDSPTQHAVGFQKAFQLIRSTNNNTKFQASTDMVIIYLSAGITSKDS
SEEDKKATLRVINEENSFLNNSVMILTYALMNDGVTGLKELAFLRDLAEQNSGKYGVLDR
TCLPVIKGSMMVLNQLSNLETTVGRFYTNLPNRMIDEAVFSLPFSDEMGDGLIMTVSKPC
YFGNLLLGIVGVDVNLAYILEDVTYYQDSLASYTFLIDDKGYTLMHPSLTRPYLLSEPPL
HTDIIHYENIPKFELVRQNILSLPLGSQIIAVPVNSSLSWHINKLRETGKEAYNVSYAWK
MVQDTSFILCIVVIQPEIPVKQLKNLNTVPSSKLLYHRLDLLGQPSACLHFKQLATLESP
TVMLSAGSFSSPYEHLSQPETKRMVEHYTAYLSDNTRLIANPGLKFSVRNEVMATSHVTD
EWMTQMEMSSLNTYIVRRYIATPNGVLRIYPGSLMDKAFDPTRRQWYLHAVANPGLISLT
GPYLDVGGAGYVVTISHTIHSSSTQLSSGHTVAVMGIDFTLRYFYKVLMDLLPVCNQDGG
NKIRCFIMEDRGYLVAHPTLIDPKGHAPVEQQHITHKEPLVANDILNHPNFVKKNLCNSF
SDRTVQRFYKFNTSLVGDLTNLVHGSHCSKYRLARIPGTNAFVGIVNETCDSLAFCACSM
VDRLCLNCHRMEQNECECPCECPLEVNECTGNLTNAENRNPSCEVHQEPVTYTAIDPGLQ
DALHQCVNSRCSQRMESGDCFGVLDCEWCMVDSDGKTHLDKSYCAPQKECFGGIVGAKSP
YVDDMGAIGDEVITLNMIKSAPVGPVAGGIMGCIMVLVLAVYAYRHQIHRRSHQHMSPLA
AQEMSVRMSNLENDRDERDDDSHEDRGIISNTRFIAAVIERRTHSPERRRRYWGRSGTES
DHGYSTMSPQEDSENPPCNNDPLSAGVDVGNHDEDLDLDTPPQTAALLSHKFHHYRLHHP
TLHHSHHLQAAVTVHTVDAEC
Download sequence
Identical sequences G3T385
ENSLAFP00000007682 XP_003411089.1.64505 ENSLAFP00000007682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]