SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000007792 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000007792
Domain Number 1 Region: 142-254
Classification Level Classification E-value
Superfamily C-type lectin-like 3.98e-38
Family Link domain 0.0014
Further Details:      
 
Domain Number 2 Region: 256-339
Classification Level Classification E-value
Superfamily C-type lectin-like 3.6e-24
Family Link domain 0.0021
Further Details:      
 
Domain Number 3 Region: 44-147
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000143
Family I set domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000007792   Gene: ENSLAFG00000009297   Transcript: ENSLAFT00000009297
Sequence length 341
Comment pep:novel supercontig:loxAfr3:scaffold_33:5082553:5084501:1 gene:ENSLAFG00000009297 transcript:ENSLAFT00000009297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGWLALPALCSFLLPWTFTIFHTALGDTAPHPGPHYLLPPIHEVIHSRRGATATLPCVL
GAPPPSYKVRWSKVELGELREMPILITNGLHARGYGPLGGRARMRRGHRLDASLVIAGVR
LEDEGRYRCELINGMEDESVALTLRLEGVVFPYQPSRGRYQFNYYEAKQACEEQDGRLAT
YAQLYQAWTEGLDWCNAGWLLDGSVRYPVLTARAPCGGRGRPGIRSYGPRDWKRDRYDAF
CFSSALAGDVFFVPGRLTLSEAHAACRRRGAVVAKVGHLYAAWKFSGLDQCDGGWLSDGS
VRFPITTPRPRCGGLPDPGVRSFGFPSPQQPAYGTYCYSEN
Download sequence
Identical sequences G3T3G8
XP_003415204.1.64505 ENSLAFP00000007792 ENSLAFP00000007792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]