SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000007813 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000007813
Domain Number 1 Region: 200-345
Classification Level Classification E-value
Superfamily PH domain-like 2.16e-45
Family Third domain of FERM 0.000000288
Further Details:      
 
Domain Number 2 Region: 89-199
Classification Level Classification E-value
Superfamily Second domain of FERM 9.03e-39
Family Second domain of FERM 0.000000755
Further Details:      
 
Domain Number 3 Region: 499-587
Classification Level Classification E-value
Superfamily Moesin tail domain 5.75e-32
Family Moesin tail domain 0.0000249
Further Details:      
 
Domain Number 4 Region: 4-88
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.13e-26
Family First domain of FERM 0.0000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000007813   Gene: ENSLAFG00000009321   Transcript: ENSLAFT00000009322
Sequence length 587
Comment pep:novel supercontig:loxAfr3:scaffold_69:1580444:1615749:-1 gene:ENSLAFG00000009321 transcript:ENSLAFT00000009322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSQEINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLQYVDNKGFPTWL
KLDKKVSAQELRKETPLQFRFRAKFYPEDVPEELIQDITQKLFFLQVKEGILSDEIYCPP
ETAVLLGSYAVQAKFGDYNKELHKSGYLSSERLVPQRVMDQHKLTRDQWEDRIQVWHAEH
RGMLRDSAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIG
FPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDT
IEVQQMKAQAREEKQQKQLERQQLETEKKRRETVEREKEQMMREKEELMLRLQDYEQKTK
KAEKELSDQIQRALQLEEERKRAQEEAERLEADRVAALRAKEELERQAVDQIKSQEQLAA
ELAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYE
PVNYHVQDNLQEEGPEYTGYSAELSSEGIMGDRNEEKRITEAEKNERVQRQLLTLTNELS
QARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAM
Download sequence
Identical sequences G3T3I0
ENSLAFP00000007813 ENSLAFP00000007813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]