SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000007874 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000007874
Domain Number 1 Region: 116-213
Classification Level Classification E-value
Superfamily LCCL domain 1.06e-25
Family LCCL domain 0.00058
Further Details:      
 
Domain Number 2 Region: 3-112
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-25
Family Spermadhesin, CUB domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000007874   Gene: ENSLAFG00000009399   Transcript: ENSLAFT00000009398
Sequence length 479
Comment pep:novel supercontig:loxAfr3:scaffold_0:44654789:44702272:-1 gene:ENSLAFG00000009399 transcript:ENSLAFT00000009398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDGCGHIVTYQDSGTMTSKNYPGTYPNHTVCEKTITVPKGKKLILRLGDLNIESQTCASD
YLLFTSSSDQYGPYCGSMTVPKELLLNTSEVTIRFKSGSHISGRGFLLTYASSDHPDLIT
CLERASHYMKTEYSKFCPAGCRDIAGDIYGNVVDGYRDTSLLCKAAIHAGVIADELGGQI
SVLQSKGLSRYEGILANGVHSRDGSLSDKRFQFASNGVNFTTVVIPLVLLVALLVAGMGI
FAAFRKRKKKGNPYGSAKAQKTGCWKKIKYPFARHQSSEFTICYDNEKEMTQKLDLITRD
MADYQQPVMIGTGTVTRKGSTFRPMDTDTSEAGLSADAGSHYDCPHRAGRHEYALPLTNQ
EPEYATPIVERHLMRANTFSAQSGYRVPGPAPTHKHSLSSGSFSPSGGAGTKSGDYQMPQ
SLKPVDGAYDQPKVNSFFPAERRDSDYLKPQMSPLLSDGYSAPRDCPKPINQTAMTALL
Download sequence
Identical sequences G3T3N1
ENSLAFP00000007874 ENSLAFP00000007874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]