SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000008000 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000008000
Domain Number 1 Region: 933-1044
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 4.58e-40
Family Pyk2-associated protein beta ARF-GAP domain 0.00036
Further Details:      
 
Domain Number 2 Region: 402-573
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.21e-29
Family G proteins 0.0000000353
Further Details:      
 
Domain Number 3 Region: 1056-1148
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.16e-16
Family Ankyrin repeat 0.0025
Further Details:      
 
Domain Number 4 Region: 673-738,873-916
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000344
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000008000   Gene: ENSLAFG00000009533   Transcript: ENSLAFT00000009537
Sequence length 1191
Comment pep:novel supercontig:loxAfr3:scaffold_2:47020257:47032066:-1 gene:ENSLAFG00000009533 transcript:ENSLAFT00000009537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRGAGALQRRTTTYLISLTLVKLESVPPPPPSPSAAAAGAPGARCTETGDPGSPRGAEE
PGKKRHERLFHRQDALWISTSSSGAGGTEPPTLSPASPARPVSPAPGRRLSLWAAPPGPP
LSGGLSPDPKPGGTTTSSRRPLLSSPSWGGPEPEGRAGGGVPGSSSPHPGTGSRRLKVAP
PPPAPKPCKTVTTSGAKAGGGKGAGSRLSWPESEGKPRVKGSKSSAGTGASAAAVTAAAA
TAGGGGSAAATFGGVGAGPGARGKLSPRKGKSKTLDNSDLHPGPPAGSPPPLTVPATPVP
AAAATAASVQLPGPAPPITLEPPAPGLKRGREGGRASTRDRKMLKFISGIFTKSTGGPPG
SGPPPATPGLSSGSGSRELLGAELRASPKALINSQEWTLSRSIPELRLGVLGDARSGKSS
LIHRFLTGSYQVLEKTESEQHKKDMLVDGQTHLVLIREEAGAPDAKFSGWADAVIFVFSL
EDENSFQAVSRFHGQLSSLRGEGRGGLALALVGTQDRISASSPRVVGDARARALCADMKR
CSYYETCATYGLNVDRVFQEVAQKVVTLRKQQQLLAACKSLPSSPSHSAASTPIAGQASN
GGHTSDYSSSLPSSPNVGHRELRAEAAAVAGLSTPGSLHRAAKRRTSLFANRRGSDSEKR
SLDSRGETTGSGRAIPIKQSFLLKRSGNSLNKEWKKKYVTLSSNGFLLYHPSVNDYNHST
HGKEMDLLRTTVKVPGKRPPRAISAFGPSASINGLVKDMSTVQMGEGPEATTPTPSPSPS
PSSLQPPPDQTSKHLLKPDRNLARALSTDCTPSGDLSPLTREPPPSPMVKKQRRKKLTTP
SKTEGSAGQAEGGGKVPELSPVPALNSTYHPKENFEFLIVSSTGQTWHFEAASFEERDAW
VQAIESQILASLQCCESSKVKLRTDSQSEAVAIQAIRNAKGNSTCVDCGAPNPTWASLNL
GALICIECSGIHRNLGTHLSRVRSLDLDDWPRELTLVLTAIGNDMANRVWESDTRGRAKP
TRDSSREERESWIRAKYEQLLFLAPLGTTEEPLGRQLWAAVQAQDVAMVLLLLAHARHGP
LDTSVEDPQLRSPLHLAAELAHVVITQLLLWYGADVSARDAQGHTALFYARQAGSQLCAD
ILLQHGCPGEGGSTATTPSAATTPSITATPSPRRRSSAASVGRADAPVALV
Download sequence
Identical sequences G3T3X3
ENSLAFP00000008000 ENSLAFP00000008000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]