SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000008025 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000008025
Domain Number 1 Region: 513-582
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.73e-18
Family Complement control module/SCR domain 0.00035
Further Details:      
 
Domain Number 2 Region: 141-212
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.53e-16
Family Complement control module/SCR domain 0.00098
Further Details:      
 
Domain Number 3 Region: 837-903
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.61e-16
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 4 Region: 262-331
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.17e-16
Family Complement control module/SCR domain 0.00075
Further Details:      
 
Domain Number 5 Region: 202-273
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000148
Family Complement control module/SCR domain 0.00059
Further Details:      
 
Domain Number 6 Region: 397-460
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000742
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 7 Region: 337-407
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000117
Family Complement control module/SCR domain 0.00071
Further Details:      
 
Domain Number 8 Region: 704-765
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000514
Family Complement control module/SCR domain 0.00048
Further Details:      
 
Domain Number 9 Region: 588-653
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000153
Family Complement control module/SCR domain 0.00086
Further Details:      
 
Domain Number 10 Region: 890-955
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000222
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 11 Region: 76-135
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000264
Family Complement control module/SCR domain 0.0000906
Further Details:      
 
Domain Number 12 Region: 8-70
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000526
Family Complement control module/SCR domain 0.00021
Further Details:      
 
Domain Number 13 Region: 772-831
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000431
Family Complement control module/SCR domain 0.00072
Further Details:      
 
Domain Number 14 Region: 669-715
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000778
Family Complement control module/SCR domain 0.0058
Further Details:      
 
Domain Number 15 Region: 471-524
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000769
Family Complement control module/SCR domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000008025   Gene: ENSLAFG00000009563   Transcript: ENSLAFT00000009565
Sequence length 1022
Comment pep:novel supercontig:loxAfr3:scaffold_13:12923072:12939720:1 gene:ENSLAFG00000009563 transcript:ENSLAFT00000009565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLFYFSGISCGPPSVVENARKFYLSGPIAVGSVIRYSCLPNFRLIGDKILRCISKDNLTA
VWDKATPRCEFHNKYSICSEPRVPGGYRNKESRPPYRHGDSVTFTCNTNFTMKGNKSVWC
QGNGTWGPTPLPTCESDYPLECPPLPKIANGHHTGENGGPLAPGLSVTYSCDRGYLLRGE
KTITCLSSGDWSALSPTCKEAQCQSPGRIPNGQVKVPTSLQVGVTVNYSCNEGYRLRGQP
SSQCVIAGQHAVWTKIPVCEVILCPPPPAIHNGRHTGSSSEPVRYGSTVIYTCDPDPEKG
VTFILIGNNTIHCTSDSQRTGIWSDSGPRCELSTSAVRCPHPQVLNGYTLSVQKKEYAYN
DSVTFACVSGFTLNGRNRARCNAQGMWDPSVPVCEKECQAPPKILNGQNKDRHIVRFDPG
TSVKYSCDPGYVLVGEEYIRCTSEGVWKPKAPQCKVAECEPIGTELFKKPQDHFIRQDVN
SSCDEGYRLGESVYQQCQGTVPWFMEIRLCKEITCPPPPVVYNGIHSGSSLEYVPYGTTV
TYTCNPGPERGVKFNLVGESTIHCISNDQETGSWSGPAPLCELSTPYVQCSDAHVANGSK
VFGKEAPYFYNDSVTFKCHDGFNLKGSGQIRCIANNTWEPEIPVCEKGSCKPVKDTQEIP
YEARVVTFNVSCQAGYRLTGFSYQKCQDAENGVWFQRFSLCKVIHCPPPPIIANGRLTGV
TGKHFLYGNEVSYECGQGQLLGEKTIQCLSDAEGHGVWNGPPPECFQSLPVTHCPSPEVK
HGYTLNKTLSSYFHNDIVYVACNTGFIMNGSHSIRCHSSNTWVPGIPTCIRKAFLGCEPP
PKIPNGWHTGEDTARFPPGVSILYSCDPGYLLVGEELLICTHERTWSQPVPFCKEVNCSF
PEYISGMQKGVEPGKMYHYGATVTVECEDGYTLEGSPQSQCQEDHRWNPPLAVCKSRKCS
LAPLICGISTGLVFLVILVAVTLYMILKDKRVTYYTNMTPKDGVLPVETREVYSIDPYSP
AS
Download sequence
Identical sequences G3T3Z4
ENSLAFP00000008025 ENSLAFP00000008025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]