SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000008039 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000008039
Domain Number 1 Region: 865-1167
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.24e-91
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000135
Further Details:      
 
Domain Number 2 Region: 215-359
Classification Level Classification E-value
Superfamily PH domain-like 5.23e-34
Family Third domain of FERM 0.0016
Further Details:      
 
Domain Number 3 Region: 107-213
Classification Level Classification E-value
Superfamily Second domain of FERM 9.68e-30
Family Second domain of FERM 0.00036
Further Details:      
 
Domain Number 4 Region: 21-106
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.03e-18
Family First domain of FERM 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000008039   Gene: ENSLAFG00000009581   Transcript: ENSLAFT00000009582
Sequence length 1171
Comment pep:novel supercontig:loxAfr3:scaffold_9:65333678:65408297:-1 gene:ENSLAFG00000009581 transcript:ENSLAFT00000009582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPFGLKLKRTRRYTVSSKSCLVARIQLLNNEFVEFTLSVESTGQESLEAVAQRLELRE
ITYFSLWYYNKQNQRRWVDLEKPLKKQLDKYAVEPTVYFGVVFYVPSVSQLQQEITRYQY
YLQLKKDILEGNIPCTLEQAIQLAGLAVQADFGDFDQYESQDFLQKFALFPVGWLQDEKV
LEEATQKVASLHQKYRGLTAPDAEMLYMQEVERMDGYGEESYPAKDSQGSDISIGACLEG
IFVKHKNGRPPVIFRWYDIANMSHNKSFFALELANKEETIQFQTEDMETAKYVWRLCVAR
HKFYRLNQCSLQTQSVTVNPVRRRSSSRMSLPKPQPYGMPPPPQLHYNGHYTEPYTSSQD
NLFVNNQNGYYCHSQTSLDRAQVDLSGRIRNGSVYSAHSTNSLNNPQPYLQPSPMSSNPS
ITGSDVMRPDCVPSHRHSALIPPSYRPTPDYETVMKQLNRGMMHAERQSHSLRNLNIGNS
YAYSRPDALVYSQPEIREHAHFTSPQSVHYPFNLNYSFHSQSPYPYPAERRPVVGAVSVP
ELTNAQLQAHDYPAPNIMKTQVYRPPPPYQYPRPANSTPDLSRHLYISSSNPDLITRRVH
HSVQTFQEDSLPVAHSLQEVSEPLTSARHAQLRKRNSIEIAGLAHSFEGMRLKERTMSAS
AADVAPRAASAGSQPGVLMERTKAGETDEQESLRCGHKKSLSDATMLVHSSEEEDGCEEG
NKTCAALSPCDYSQEPQLSYSCSSVAPFAGPLHILEPKLHVTETEKRVRDVSPIRMLAEA
QRPRRDGPLMPSMSESDLTTSGRYRARRDSLKKRPVSDLLSGKKNIVEGLPPLGGMKKSQ
GGTKKIGPLKLAALNGLSLSRLPLPDEGKEVSTRATNDERCQILEQRLEQGMVFTEYERI
LKKRLVDGECSTARLPENAERNRFQDVLPYDDARVELVPTKENNTGYINASHIKVSISGI
EWDYIATQGPLQNTCQDFWQMVWEQGIAIIAMVTAEEEGGREKSFRYWPRLGSRHNTVTY
GRFKITTRFRTDSGCYATTGLKMKHLLTGQERTVWHLQYTDWPEHGCPEDLKGFLSYLEE
IQSVRRHTNSTSEPKSPNPPLLVHCSAGVGRTGVVILSEIMIACLEHNEVLDIPRVLDVL
RQQRMMMVQTLCQYTFVYRVLIQFLKSSRLI
Download sequence
Identical sequences G3T405
ENSLAFP00000008039 ENSLAFP00000008039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]