SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000008097 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000008097
Domain Number 1 Region: 360-643
Classification Level Classification E-value
Superfamily Kelch motif 2.48e-46
Family Kelch motif 0.0023
Further Details:      
 
Domain Number 2 Region: 781-929
Classification Level Classification E-value
Superfamily C-type lectin-like 3.21e-23
Family C-type lectin domain 0.0036
Further Details:      
 
Domain Number 3 Region: 126-248
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-22
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 4 Region: 1061-1107
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000502
Family Laminin-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000008097
Domain Number - Region: 97-129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000778
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 246-283
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0109
Family EGF-type module 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000008097   Gene: ENSLAFG00000009643   Transcript: ENSLAFT00000009650
Sequence length 1427
Comment pep:novel supercontig:loxAfr3:scaffold_19:26480367:26692634:-1 gene:ENSLAFG00000009643 transcript:ENSLAFT00000009650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMVAVAAATEARLRRRTVVTTAPAGRNGRRRRDWDVTGAGRPGLGAGLRLPRLLSPPLPP
RLLLLLLLPPLLLLLPWAAEAAAAAAIVSGTAAAEARECDRPCVNGGRCNPGTGQCVCPA
GWVGEQCQHCGGRFRLTGSSGFITDGPGNYKYKTKCTWLIEGQPNRIMRLRFKHFATECS
WDHLYVYDGDSIYAPLVAAFSGLIVPERDGNETVPEVVATSGYALLHFFSDAAYNLTGFN
ITYNFDMCPNNCSGRGECKVNNTSNTAQCECSENWKGEACDIPHCAHTCGFPHRGICNSS
DVTGCSCFSGWQGPGCSIPVPANQSFWTQEEYSNLKLPRASHKAVVNGNIMWVVGGYMFN
HSDYTMVLAYDLASREWLTLNQSVNNVVVRYGHSLALYEDKIYMYGGKIDSTGNVTSELR
VFHIHNESWVLLTPKAKEQYAVVGHSAHIVTLTTGRVVMLVIFGHCPLYGYISNVQEYDL
DKNTWSILHTQGALVQGGYGHSSVYDNRTKALYVHGGYKAFSANKYRLADDLYRYDVDTQ
MWTILKDSRFFRYLHTAVIVSGTMLVFGGNTHNDTSMSHGAKCFSSDFMAYDIACDRWSV
LPRPDLHHDVNRFGHSAVLHNGTMYVFGGFNSLLLSDILAFTSERCEVHRSEAACSAAGP
GIRCVWDMGSSECISWELATGAQEEKLKSECFSKSTFDHDRCDQHTDCYSCTANTNGCHW
CSDHCIPTNHSCTEGQISISIYENCPKDNPMYYCNKKTSCRSCALDQNCQWEPRNQECIA
LPENICGSGWHLVGNACLKITAAKENYDNAKLSCRNHNAFLASLTTQKKVEFVLKQLRVM
QSSQSTSKLTLTPWVGLRKINVSYWCWEDMSPFTNSSLQWMPSEPSDAGFCGILSEPSTR
GLKAATCINPLNGSVCERPANHSAKPCRPPCALRTACGECTSGSSECMWCSNMKQCVDSN
AYVASFPFGQCMEWYTMSSCPPENCSGYCTCSHCLEQPGCGWCTDPSNTGKGKCIEGSYK
GPMKMPPQAPTGNSYPQPYLNSSMCLEDSRFNWSFIQCPACQCNGHSKCINQSICEKCEN
LTTGNHCETCISGFYGDPTNGGKCQPCKCNGHASLCNTNTGKCFCTTKGVKGDECQLCEV
ENRYQGNPLKGTCYYTLLIDYQFTFSLSQEDDRYYTAINFVATPDEQNRDLDMFINASKN
FNLNITWAASFSAGTQAGEEMPVVSKTNIKEYKDSFSNEKFDFRNHPNITFFVYVSNFTW
PIKIQIAFSQHSNFMDLVQFFVTFFSCFLSLLLVAAVVWKIKQSCWASRRREQLLREMQQ
MASRPFASVNVALETDEEPPDLIGGSIKTVPKPIALEPCFGNKAAVLSVFVRLPRGLGGI
PPPGQSGLAVASALVDISQQMPIVYKEKSGAVRNRKQQPPAQPGTCI
Download sequence
Identical sequences G3T448
ENSLAFP00000008097 ENSLAFP00000008097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]