SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000008208 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000008208
Domain Number 1 Region: 134-247
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.02e-38
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 2 Region: 36-132
Classification Level Classification E-value
Superfamily C-type lectin-like 5.13e-37
Family Link domain 0.00000229
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000008208   Gene: ENSLAFG00000009790   Transcript: ENSLAFT00000009792
Sequence length 277
Comment pep:novel supercontig:loxAfr3:scaffold_3:76828239:76851793:-1 gene:ENSLAFG00000009790 transcript:ENSLAFT00000009792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVIFICLFVLLWEEAHGWGYKNGIFHNSIWLEQAAGVYHREARSGKYKLTYAEAKAVCEY
EGGHLATYKQLEAARKIGFHVCAAGWMAKGRVGYPIVKPGLNCGFGKTGIIDYGIRLNRS
ERWDAYCYNPHAKECGGVFTDPKAIFKSPGFPNEYGDNQICYWHIRLKYGQRIHLSFLDF
DLEDDPACLADYVEVYDSYDDVHGFVGRFCGDELPEDIISTGNVMTLKFLSDASVTAGGF
QIKYVAVDPVPKSSPGKNTTTTSTGNKNFLAGRFSHL
Download sequence
Identical sequences G3T4D1
ENSLAFP00000008208 XP_003405895.1.64505 ENSLAFP00000008208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]