SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000008278 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000008278
Domain Number 1 Region: 160-266
Classification Level Classification E-value
Superfamily C-type lectin-like 3.88e-40
Family Link domain 0.0039
Further Details:      
 
Domain Number 2 Region: 271-354
Classification Level Classification E-value
Superfamily C-type lectin-like 4.89e-30
Family Link domain 0.00082
Further Details:      
 
Domain Number 3 Region: 46-158
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000175
Family V set domains (antibody variable domain-like) 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000008278   Gene: ENSLAFG00000009878   Transcript: ENSLAFT00000009878
Sequence length 356
Comment pep:novel supercontig:loxAfr3:scaffold_28:18054182:18063007:1 gene:ENSLAFG00000009878 transcript:ENSLAFT00000009878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPLLLLLLLPYASGLPFYNGFYYSNGPNGWGLGHGEGLFNGVKLVVETPEETLFTHQGA
NVTLPCRYHYEPALASPRPVRIKWWKLSENGAPEKDVLVAIGLRHRSFGDYQGRVHLRQE
REWEVSLEIRDLQLEDYGRYRCEVIDGLEDESGLVELELRGVVFPYQPPQGRYQLNFHEA
QQACEEQDAVLASFEQLFRAWEEGLDWCNAGWLQDASVQYPIMLPRQPCGGLGLAPGVRS
YGPRHRRLHRYDVFCFATALKGRVYYLEHPEKLTLTEAKAACQEDGAQIAKVGQLFAAWK
FRGLDRCDAGWLADGSVRYPVAHPRPNCGSAEPGVRSFGFPDPQSHKYGVYCYHQR
Download sequence
Identical sequences G3T4I8
ENSLAFP00000008278 XP_003413832.1.64505 ENSLAFP00000008278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]