SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000008284 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000008284
Domain Number 1 Region: 14-152
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.23e-45
Family Galectin (animal S-lectin) 0.0000708
Further Details:      
 
Domain Number 2 Region: 188-319
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-35
Family Galectin (animal S-lectin) 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000008284   Gene: ENSLAFG00000009885   Transcript: ENSLAFT00000009885
Sequence length 320
Comment pep:novel supercontig:loxAfr3:scaffold_47:622071:630488:1 gene:ENSLAFG00000009885 transcript:ENSLAFT00000009885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LASTSSHNQKIYKSVPFQGTILGGLQDGLQIIIRGTVLSSDESRFAVDFQTGDSENDIAF
QFNPRFEEGGYVACNTKQNGSWGLEERKMKMPFQKGKPFEICVLVQSSDFKVKVNWSHFL
QYSHRVPFHGVDTISVEGPLQLDSIKFQEHNWKFHEGRYEKVALHQIVPVRVCDSTTIPL
TVHPSPTYTLPYFTAISGGLCPYKTIIVSGTVLPNAQTFHIRLLSGSDITFHLNPRFNEN
AVVHNTKLNNSSGSKEHSLPGKMPFKCGQNFSVRIVCKNHCLRVTVDGKLLCEYRYCLKS
LLAINNLEVAGDIQLAHVQA
Download sequence
Identical sequences G3T4J2
ENSLAFP00000008284 ENSLAFP00000008284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]