SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000008467 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000008467
Domain Number 1 Region: 128-318
Classification Level Classification E-value
Superfamily vWA-like 1.95e-60
Family Integrin A (or I) domain 0.0000662
Further Details:      
 
Domain Number 2 Region: 2297-2503
Classification Level Classification E-value
Superfamily vWA-like 5.15e-57
Family Integrin A (or I) domain 0.0002
Further Details:      
 
Domain Number 3 Region: 433-617
Classification Level Classification E-value
Superfamily vWA-like 5.7e-57
Family Integrin A (or I) domain 0.00016
Further Details:      
 
Domain Number 4 Region: 1222-1377
Classification Level Classification E-value
Superfamily vWA-like 2.97e-41
Family Integrin A (or I) domain 0.00042
Further Details:      
 
Domain Number 5 Region: 2524-2726
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.79e-34
Family Laminin G-like module 0.051
Further Details:      
 
Domain Number 6 Region: 725-896
Classification Level Classification E-value
Superfamily Fibronectin type III 2.24e-24
Family Fibronectin type III 0.00088
Further Details:      
 
Domain Number 7 Region: 1755-1925
Classification Level Classification E-value
Superfamily Fibronectin type III 6.02e-22
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 8 Region: 2027-2196
Classification Level Classification E-value
Superfamily Fibronectin type III 8.03e-21
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 9 Region: 909-1078
Classification Level Classification E-value
Superfamily Fibronectin type III 8.64e-21
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 10 Region: 1568-1726
Classification Level Classification E-value
Superfamily Fibronectin type III 1.17e-20
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 11 Region: 1384-1471
Classification Level Classification E-value
Superfamily Fibronectin type III 2.06e-20
Family Fibronectin type III 0.00043
Further Details:      
 
Domain Number 12 Region: 335-428,624-712
Classification Level Classification E-value
Superfamily Fibronectin type III 3.25e-20
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 13 Region: 1939-2023
Classification Level Classification E-value
Superfamily Fibronectin type III 3.61e-19
Family Fibronectin type III 0.0007
Further Details:      
 
Domain Number 14 Region: 1092-1178
Classification Level Classification E-value
Superfamily Fibronectin type III 1.37e-17
Family Fibronectin type III 0.00079
Further Details:      
 
Domain Number 15 Region: 1471-1562
Classification Level Classification E-value
Superfamily Fibronectin type III 3.37e-17
Family Fibronectin type III 0.00061
Further Details:      
 
Domain Number 16 Region: 2206-2291
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000122
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 17 Region: 26-108
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000111
Family Fibronectin type III 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000008467   Gene: ENSLAFG00000010089   Transcript: ENSLAFT00000010100
Sequence length 3122
Comment pep:novel supercontig:loxAfr3:scaffold_0:90663448:90780777:1 gene:ENSLAFG00000010089 transcript:ENSLAFT00000010100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRNRLPPALAALGAALLLSSIEAEVDPPSDLNFKIIDENTVHMSWARPADPIVGYRITVD
PTTEGPTKEFTLAASTTETLLSDLIPEIEYVVTIASYDEVEESVPVIGQLTIQTGGPTKP
GEKKPRKTEIQKCSVSAWTDLVFLVDGSWSVGRNNFKYILDFIAALVSAFDIGEAKTRVG
VIQYSSDTRTEFNLNQYYQRDELLAAIKKIPYKGGNTMTGDAIDYLIKNTFTESAGARVG
FPKVAIIITDGKSQDEVEIPARELRNIGVEVFSLGIKAADAKELKQIASTPSLNHVFNVA
NFDAIVDIQNEIISQVCSGVDEQLGELVSGEEVIEPPSNLIATEVSSKYIKLSWSPSPSP
VTSYKVLLTPMTAGSRQHALSVGPQTTMLSVRDLSADTEYQISVSAMKGLTSSEPVSIME
KTQPMKVQVECSRGVDIKADIVFLVDGSYSIGIANFVKVRAFLEVLVKSFDISPNRVQIS
LVQYSRDPHTEFTLKKFTKVEDIIEAINTFPYRGGSTNTGKAMTYVREKIFVPSKGSRSN
VPKVMILITDGKSSDAFRDPAIKLRNSDVEIFAVGVKDAVRSELEAIASPPPETHVFTVE
DFDAFQRISFELTQSICLRIEQELAAIKKKVAYVPPKNLTFSEVTSYSFKSNWSPAGENV
FSYHITYKEMAGDGEVTVVEPASSTSVVLTNLKPETQYLVNVTAEYEDGFSVPISGEETT
EEVKGAPRNLKVTDETTDSFKITWTQAPGRVLRYRIIYKPVNGGESKEVTTPANQRRRTL
ENLTPDTKYEVSVIPEYYSGPGSPLTGNAATEPNEVRGNPRDLKVSDPTTSTMKLSWTRA
PGKVKQYLITYTAVAGGETQEVTVRGDTTNTVLSGLKEGTQYALSVTALYASGAGDALFG
EGTTLEERGSPQNLVTKDITDTSIGAYWTSAPGMVRGYRVSWKSLYDDIETGEKNLPGDS
IHTVIENLQPETKYKISVFATYTSGEGEPLTGEATTEISQESKTLKVDEETENTMRVTWK
PAPGKVVNYRVIYRPRGGGKQMVAKVPPTVTSTVLKRLQPQTTYDITVLPIYKTGEGKLR
QGSGTTASRFKSPRNLKTSDPTMSSFRVTWEPAPGEVKGYKVTFHPTGDDRRLGELVVGP
YDNTVVLEELRAGTTYKVNVFGMFDGGESSPLVGQEMTTLSDTTVMPVLSSGMERLTRAE
ADIVIVMIVEHCGPNLRPVKSSFSYVSLEMGQKSTNVALAQYSGDPRTEWQLNAHRDKQS
LLQAVANLPYKGGNTLTGMALNFIRQQSFKTQAGMRPRARKIGVLITDGKSQDDVEGPSK
KLKDEGVELFAVGIKNADEVELKMIATDPDDTHAYNVADFESLSRIVDDLTINLCNSVKG
PGDLEAPSNLVISERTHRSFRVSWTPPSDSVDRYKVEYYPVSGGKRQEFYVSRMETSTVL
KDLKPETEYVVNVYSVVEDEYSEPLKGTEKTLPVPVVSLNIYDVGPTNMRVQWQPVGGAT
GYSLSYEPINATEPTKAKEMRVGPTVNEVQLTDLIPNTEYAVTVQAALHDLTSEPVTARQ
VTSPLPGPRDLKLRDVTHSTMNVLWEPAPGKVRKYIIRYKTPEEDAKEVEADRSRTNTPL
RDLFSQTLYTISVSAVYDEGESPPVTAQDTTKHVPAPTNLRITEVTPETFRGTWDHGASD
VSLYRITWAPFGSSDKMETILNGDENTLVFQNLNPNTLYEVSVTAIYPDESESDDLVGSE
RTVRLIPLTTQAPKSGPRNLQVYNATSNSLTVKWDPASGRVQKYRITYQPSTGEGNEQTT
TIGGRQNSVVLQKLKPDTPYTITVSSLYPDGEGGRMTGRGKTKPLNTVRNLRVYDPSTST
LNVRWDHAEGNPRQYKLFYAPTAGGPEELVPIPGNTNYAILRNLQPDTPYTVTVVPVYSE
GDGGRTSDTGRTLVRGLARNVQVYNPTPNSLDVRWDPAPGPVQQYRIVYSPVAGTRPSES
IVVPGNTGMVHLERLIPDTPYSVNIVALYSDGEGNPSPGQGRTLPRSGPRNLRVFGETTN
SLSVAWDHADGPVQQYRIIYSPTVGDPIDEYTTVPGRRNNVILQPLQPDTPYKITVIPVY
EDGDGGHLTGNGRTVGLLPPQNIHISDEWYTRFRVSWDPSPSPVLGYKIVYKPVDSSEPM
EAFVGEVTSYTLHNLNPSTTYDVNVYAQYDSGLSVPLTDKGTTLYLNVTDLKTYQVGWDT
FCVRWSPHRAATSYRLKLNPADGTRGQEITVRGSETSHCFTGLSPDTEYGVTVFVQTPNL
EGPGVPVKEHTTVKPTEAPTEPPTPPPPPTIPPARDVCKGAKADIVFLTDASWSIGDDNF
NKVVKFIFNTVGAFDEISPAGIQVSFVQYSDEVKSEFKLNTYNDKAQALGALQNIRYRGG
NTRTGKALTFIKEKVLTWESGMRKNVPKVLVVVTDGRSQDEVKKAALIIQQSGFSVFVVG
VADVEYNELANIASKPSERHVFIVDDFESFEKIEDNLITFVCETATSNCPLIYLDGYTSP
EYKGFKMLEAYNLTEKNFASVQGVSLESGSFPSYSAYRLQKNAFVNQPTVDLHPNGLPPS
YTIILLFRLLPETPNDPFAIWQITDRDYKPQVGVIVDPSSKTLSFFNKDTRGEVQTITFD
TDEVKTLFYGSFHKIHIVVTSKSVKIYIDCYEIIEKDIKEAGNITTDGYEILGKLLKGER
KSATFQIQNFDIVCSPVWTSRDRCCDIPSRRDEAKCPALPNACTCTQDSVGPPGPPGPAG
GPGAKGPRGERGISGAIGPPGPRGDTGPPGPQGPPGPQGPNGLSIPGEQGRQGMKGDAGE
PGLPGRTGTPGLPGPPGPMGPPGDRGFTGKDGAMGPRGPPGPPGSPGSPGVTGASGKPGK
PGDHGRPGPSGLKGEKGDRGDIASQNMMRAVARQVCEQLISGQMNRFNQMLNQIPNDYHS
NRNQPGPPGPPGPPGNAGARGEPGPGGQPGFPGSPGMQGPPGERGLPGEKGERGIGSPGP
RGSPGPPGPQGESRTGPPGSTGSRGPPGPPGRPGNLGIRGPPGPPGYCDSSQCASIPYNG
QGYPEPYVPEGGAYLPEREPFVVPVEPERTTDEYEDYGADVPAEERPPTQHHARARRSEA
GR
Download sequence
Identical sequences G3UA80
ENSLAFP00000008467 ENSLAFP00000024738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]