SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000008545 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000008545
Domain Number 1 Region: 71-209
Classification Level Classification E-value
Superfamily C-type lectin-like 1.31e-39
Family C-type lectin domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000008545   Gene: ENSLAFG00000010198   Transcript: ENSLAFT00000010198
Sequence length 212
Comment pep:novel supercontig:loxAfr3:scaffold_15:53535532:53542326:1 gene:ENSLAFG00000010198 transcript:ENSLAFT00000010198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRGQPQEREREVWWHRVKVWPTAVVSLSLLSACFIVSCLVNRDNSVYTKIGKKLFKLQD
HQEYHSRLTCFNEGKGLKDWHCCPTPWSPFQSSCYFISTELKNWTDSEKNCSEMGAHLMT
ISTKDEQQFINQKLDGNFAYYVGLSDPEGKHQWQWVDRSPYNESVSFWHHGEPNTHDERC
VIINFRDENWGWNDASCGETQRSICEMTKIYL
Download sequence
Identical sequences G3T558
ENSLAFP00000008545 XP_003410853.1.64505 ENSLAFP00000008545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]