SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000008573 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000008573
Domain Number 1 Region: 3-149
Classification Level Classification E-value
Superfamily vWA-like 0.0000000000000823
Family Integrin A (or I) domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000008573   Gene: ENSLAFG00000010235   Transcript: ENSLAFT00000010235
Sequence length 518
Comment pep:novel supercontig:loxAfr3:scaffold_59:11348651:11375581:-1 gene:ENSLAFG00000010235 transcript:ENSLAFT00000010235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTVVVMDVSLSMTRPVSVEGSEEYQRKHLAAHGLTMLFEHMATNYKLEFTALVVFSSLW
ELMVPFTRDYNTLQEALSNMDDYDKTCLESALVGVCNIVQQEWGGAIPCQVVLVTDGCLG
IGRGSLRHSLATHNQRSENNRFPLPFPFPSKLYIMCMANLEELQSTDSLDCLERLIDLNN
GEGQIFTIDGPLCLKNVQSMFGKLIDLAYTPFHAVLKCGHLTADVQVFPRPEPFVVDEEI
DPIPKVINTDLEIVGFIDIADISSPPVLSRHLVLPIALNKEGDEVGTGITDDNEDENSAN
QIAGKIPNFCVLLHGSLKVEGMVAIVQLGPEWYGMLYSQADSKKKSNLMMSLFEPGPEPL
PWLGKMAQLGPISDAKENPYGEDDNKSPFPLQPKNKRSYAQNVTVWIKPSGLQTDVQKIL
RNARKLPEKTQTFYKELNRLRKAALAFGFLDLLKGVADMLERECTLLPDTAHPDAAFQLT
HAAQQLKLASTSTSEYAAYDHNITPLQTDFSGSSTERM
Download sequence
Identical sequences G3T580
ENSLAFP00000008573 XP_010596351.1.64505 ENSLAFP00000008573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]