SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000008580 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000008580
Domain Number 1 Region: 93-232
Classification Level Classification E-value
Superfamily C-type lectin-like 2.27e-39
Family C-type lectin domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000008580   Gene: ENSLAFG00000010246   Transcript: ENSLAFT00000010243
Sequence length 235
Comment pep:novel supercontig:loxAfr3:scaffold_15:52818186:52830999:-1 gene:ENSLAFG00000010246 transcript:ENSLAFT00000010243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALEITYAEVRFKNESDTSGANSERPAAPKEKTSPQQSNDGFPKKLPASLLILLLLLAIS
SFIAFIIFLQEYSRLLKEKKNSKEVFHEKWICEKTNLNVEGKVCGCCPVNWIISNTSCYF
ISSEAKTWTESEKNCSGMGAHLVVINTKEEQLLITQKLKKSSYYLGLSDPEATHQWQWVD
QSPYSTSVTFWHHGEPDNHTGPCVLINIRDGSWGWDDASCDVPQKSICELMKIYL
Download sequence
Identical sequences G3T585
ENSLAFP00000008580 ENSLAFP00000008580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]