SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000008581 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000008581
Domain Number 1 Region: 56-226
Classification Level Classification E-value
Superfamily vWA-like 3.5e-18
Family Integrin A (or I) domain 0.023
Further Details:      
 
Domain Number 2 Region: 323-385
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.46e-17
Family TFIIH p44 subunit cysteine-rich domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000008581   Gene: ENSLAFG00000010244   Transcript: ENSLAFT00000010244
Sequence length 393
Comment pep:novel supercontig:loxAfr3:scaffold_7:73389102:73407295:1 gene:ENSLAFG00000010244 transcript:ENSLAFT00000010244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRH
LYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTEL
SGNPRKHITSLKKAVDMTCHGEPSLYNSLNMAMQTLKHMPGHTSREVLIIFSSLTTCDPS
NIYDLVKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHVSPPP
ASSNSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDSNTEPGLTLGGYFCPQCRAKYCE
LPVECKVCGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHVYVC
TVCQNVFCVDCDVFVHDSLHCCPGCIHKIPSPS
Download sequence
Identical sequences G3T586
ENSLAFP00000008581 ENSLAFP00000008581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]