SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000008659 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000008659
Domain Number 1 Region: 34-780
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.5e-274
Family Motor proteins 0.000000000223
Further Details:      
 
Domain Number 2 Region: 2045-2134
Classification Level Classification E-value
Superfamily PH domain-like 3.44e-19
Family Third domain of FERM 0.018
Further Details:      
 
Domain Number 3 Region: 1927-2044
Classification Level Classification E-value
Superfamily Second domain of FERM 1.57e-18
Family Second domain of FERM 0.0072
Further Details:      
 
Domain Number 4 Region: 1827-1934
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000284
Family Ras-binding domain, RBD 0.05
Further Details:      
 
Domain Number 5 Region: 1224-1326
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000225
Family Ubiquitin-related 0.044
Further Details:      
 
Domain Number 6 Region: 1318-1412
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000034
Family Second domain of FERM 0.0065
Further Details:      
 
Domain Number 7 Region: 787-851
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000389
Family Motor proteins 0.015
Further Details:      
 
Domain Number 8 Region: 1557-1602
Classification Level Classification E-value
Superfamily SH3-domain 0.0000908
Family SH3-domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000008659   Gene: ENSLAFG00000010345   Transcript: ENSLAFT00000010339
Sequence length 2149
Comment pep:novel supercontig:loxAfr3:scaffold_46:7131653:7238101:-1 gene:ENSLAFG00000010345 transcript:ENSLAFT00000010339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDPPSANKTTVAIGGIIKKTEPGKVLVEDDEGKEHWICAKDLGSLSLMHPNSVQGVDDMI
RLGDLNEAGMVHNLLIRYQQNKIYTYTGSILVAVNPFQALPLYTLEQVQLYYRHHVGELP
PHVFAIANSCYFNMKRNKRDQCCIISGESGAGKTETTKLILQFLATVSGQHSWIEQQVLE
ANPILEAFGNAKTVHNDNSSRFGKYIDIYFNHSGVIEGARIEQFLLEKSRVCRQAPDERN
YHIFYCMLMGMSAEEKRLLCLGMPSEYHYLTMGNSSSCEGLDDAKDYAHIRSAMKILMFS
DSENWDISKLLAAILHLGNVEFMAAVFENLDSSDVMEPSTLPIVMKLLEVQHQALQDCLT
KHSIIIRGEFVIRPLNITQAADRRDAFVKGIYGHLFLWVVKKINAAIFTPPSQDPKHVRR
AIGLLDIFGFENFQSNSFEQLCINLANEHLQQFFVQHVFTMEQEEYREEHIAWDYIHYTD
NRHTLDLLALKPMSIMSLLDEESRFPQGTDITMLQKLKSVHAHNKAFLQPKTIHDVRFGI
AHFAGEVYYKTEGFLEKNRDVLSTDILSLVYSSNNKFLKEIFKLEATETKTAEAKRPPTL
AGQFKQSLDQLMKILTTCQPYFIRCIKPNEYKKPLLFDRELCLQQLRYSGMMETVQIRKS
GFPIRYTFEEFSQRFQVLLPSAMRMQLRDKFQQMTLCIADMWLKTDKDWKMGKTKIFLKD
HQDTLLEIQRSQALDAAALSIQRVLRGYKHRKEFLRQKWAAVTLQANWRGFSTRRNFKLI
LLGFERLQAIARSHLLARQYEALRERIIRLQAQCRGYLIRRTAQERRRAVVIIQAHARGM
AARRSFRRRKANWQEEVYLASVRCAAASCLSLSTVRPAVTFLHGCMQGPLVIPAAQQRDP
SAPPAKKRESIYDTVTDTEMVEKVFGFLPSMIGGQEGQAPPRFEDLETRTKQLPEVDLDT
VPMVEETEEEAYGLAEYTFPKFAATYFQKSASHTHIRRPLRHPLLYQEDDADCEAALAVW
GIILRFMGDLPEPVLFARTKRRDSSAIQQIHNTLGAEGSTQPPQSGGSAQRPSHRDRGTK
EISSMKLKRSSRITSQVVSQLSIEKEAFELNGPISDQPMSNLEKVHFIVAHAILRPNLRD
EIYCQICKQLSENFKMSSLARGWILLSLCLGCFPPSERFMKYLLNFIGQGPAGYGSFCAE
RLRRTYANGVRMEPPTWLELQAVKSKKHIPIHVILVTGESLIIMVDSASTAREVCLHIAR
KQGLSDHVGFSLHVAVYDKFWSLGSGRDHIMDAIAQCEQLARERGESERQSPWRIYFRKE
FFTPWHDSREDPVSTELIYRQVLHGVWSGEYSFEREEELVELLARHCYVQLGASAGSEAI
QELLPSCIPTKLYRTKPPEKWASLVAAAHTKAPYTQKQATALAVREQVVDMARLQWPLLF
SRLFEVTTLSGPRLPRAKLILAVNWKGLCFLDQREKLLLELSFPEVTGLVTNRTARGGQR
LTLSTLREEEYELATPSSVAIAELVAMFLEGLKDRSVFAMALQDSPTPAPRDDATLLPFK
KGDLLILTKKQGLLASENWTLGQNDRTGRTGLVSTACLYIIPTVVKPSAQLLSLLAMSPE
KRKLVAQERRPAEPSPEEQPKEKVHTLEEFSYEFFRAPEKESVSKAMFPLARTRGHLWAH
SSEPLRQPLLKRVHANADLRDCACQTFLPILKYMGDYPSRQAWSSLELTDQIFSLALQEE
ALQDEVYCQILKQLTHNSNRHSEERGWQLLWLCTGLFPPGKELLPHAQKFVDTRRKKQLA
PDCSRRLQRVLRVGPRKQPPHQVEVEAAEHNVTRICHKVYFPNDTSEMLEVGTNTRVRDA
CQSIATKLQLASWEGCSLFVKIADKVFSQKEGDFFFDSLRQVSDWVKKNKPQKEGAPVTV
PYQVFFMRKLWLNVSPGKDVNADTILHYHQELPKYLRGFHKCSREDVLHLAGLIYKAQFD
NDRSQLASIPKILRQLVPENLTRLMSSEEWKKESIPLAYDKHVDKTVEEAKVAFLKWICR
WPTFGSAFFEVKQTSEPSYPDIVLIAINRHGVLLIHPKTKELLTTYPFTKIASWSSGSTY
FHMVLGSLGRGSRLLCETSLGYKMDDLLTSYVQQLLTTMNRQRGSRAPD
Download sequence
Identical sequences G3T5F1
ENSLAFP00000008659 ENSLAFP00000008659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]