SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000008666 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000008666
Domain Number 1 Region: 59-102
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000381
Family EGF-type module 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000008666   Gene: ENSLAFG00000010348   Transcript: ENSLAFT00000010347
Sequence length 163
Comment pep:novel supercontig:loxAfr3:scaffold_30:23169659:23176806:-1 gene:ENSLAFG00000010348 transcript:ENSLAFT00000010347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSVVHRAWVFLPILEIGFHLLQAVLSTTVIPSCIPGESDDNCTALVQTEDNPRVAQVSIT
KCGSDMNGYCLHGHCIFLVNMNEHYCRCDVGYTGVRCEHFFLTVHQPLSKEYVALTVILT
IFFLVTVAGSLYYFCRWYRNRKSKEPKKEYERVTSGDPTLPQV
Download sequence
Identical sequences G3T5F8
ENSLAFP00000008666 ENSLAFP00000008666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]