SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000008694 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000008694
Domain Number 1 Region: 347-619
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.48e-85
Family Eukaryotic proteases 0.00000000155
Further Details:      
 
Domain Number 2 Region: 104-190
Classification Level Classification E-value
Superfamily Kringle-like 2.9e-31
Family Kringle modules 0.0000251
Further Details:      
 
Domain Number 3 Region: 211-298
Classification Level Classification E-value
Superfamily Kringle-like 4.11e-27
Family Kringle modules 0.0000218
Further Details:      
 
Domain Number 4 Region: 45-101
Classification Level Classification E-value
Superfamily GLA-domain 1.35e-18
Family GLA-domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000008694   Gene: ENSLAFG00000010383   Transcript: ENSLAFT00000010384
Sequence length 619
Comment pep:novel supercontig:loxAfr3:scaffold_21:2752671:2764206:-1 gene:ENSLAFG00000010383 transcript:ENSLAFT00000010384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHVRGPRLPGCLALAALFSLVHSQHVFLAPQQALSMLQRVRRANSGFLEEMRKGNLERE
CVEEQCSYEEAFEALESPSDTEAFWVKYTACEPVRTPRENLVECLEGNCAVGLGTNYHGN
VSFTRSGIECQLWRSRYPHKPEINFTAYHEAYLKENFCRNPDSSTTGPWCYTTDPTVRRE
ECSIPVCAPPGGEGVTVALTPRSRVKPSPPSELCVLDRGQQYQGSLAVTTQGSPCLAWAS
SEAKALSKDLDFSKSVPLVENYCRNPDGDAEGAWCYVAGKPGDFEYCDLNYCEEPLEEEA
GDGLDEDPDASIQGRTTAEEFQSFFNPRTFGAGEADCGLRPLFEKKSLEDKREKELLDSY
IAGRIVEGWDAEQGIAPWQVMLFRKSPQELLCGASLISDRWILTAAHCLLYPPWDKNFTE
NDLLVRLGKHSRTRYERNFEKISMLEKIYIHPRYNWRDNLDRDIALLKLKKPIAFSNYIH
PVCLPDKEPLSKLLQAGYKGRVTGWGNLKETWTASTSEVQPSVLQVVHLPIVERPVCKAS
TRIRITDNMFCAGFKPNEGQRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGK
YGFYTHVFRLKRWILKVVG
Download sequence
Identical sequences G3T5I1
ENSLAFP00000008694 ENSLAFP00000008694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]