SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000008746 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000008746
Domain Number 1 Region: 69-255
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-44
Family SPRY domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000008746   Gene: ENSLAFG00000010441   Transcript: ENSLAFT00000010443
Sequence length 637
Comment pep:novel supercontig:loxAfr3:scaffold_44:15516878:15643561:1 gene:ENSLAFG00000010441 transcript:ENSLAFT00000010443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRREAAAAAPAVTPGGESVSSGPARGGPAPALVAGSSAAASFPHGDSALNEQEKELQRRL
KRLYPAVNEQETPLPRSWSPKDKFSYIGLSQNNLRVHYKGHGKTPKDAASVRATHPIPAA
CGIYYFEVKIVSKGRDGYMGIGLSAQGVNMNRLPGWDKHSYGYHGDDGHSFCSSGTGQPY
GPTFTTGDVIGCCVNLINNTCFYTKNGHSLGIAFTDLPPNLYPTVGLQTPGEVVDANFGQ
HPFVFDIEDYMREWRTKIQAQIDRFPIGDREGEWQTMIQKMVSSYLVHHGYCATAEAFAR
STDQTVLEELASIKNRQRIQKLVLAGRMGEAIETTQQLYPSLLERNPNLLFTLKVRQFIE
MVNGTDSEVRCLGGRSPKSQDSYPVSPRPFSSPSMSPSHGMNIHNLASGKGSTAHFSGFE
SCSNGVISNKAHQSYCHSKHQSSSLNVPELNSINMSRSQQVNNFTSNDVDMETDHYSNGV
GETSSNGFLNGSSKHDHEMEDCDTEMEVDSSQLRRQLCGGSQAAIERMIHFGRELQAMSE
QLRRECGKNTANKKMLKDAFSLLAYSDPWNSPVGNQLDPIQREPVCSALNSAILETHNLP
KQPPLALAMGQATQCLGLMARSGIGSCAFATVEDYLH
Download sequence
Identical sequences G3T5M3
ENSLAFP00000008746 ENSLAFP00000008746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]