SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000008751 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000008751
Domain Number 1 Region: 469-533,571-669
Classification Level Classification E-value
Superfamily PH domain-like 1.68e-29
Family Pleckstrin-homology domain (PH domain) 0.0046
Further Details:      
 
Domain Number 2 Region: 677-802
Classification Level Classification E-value
Superfamily PH domain-like 1.26e-19
Family Pleckstrin-homology domain (PH domain) 0.0099
Further Details:      
 
Domain Number 3 Region: 1089-1221
Classification Level Classification E-value
Superfamily Second domain of FERM 3.27e-18
Family Second domain of FERM 0.0069
Further Details:      
 
Domain Number 4 Region: 990-1067
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000443
Family Ubiquitin-related 0.078
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000008751
Domain Number - Region: 1222-1284
Classification Level Classification E-value
Superfamily PH domain-like 0.000615
Family Third domain of FERM 0.041
Further Details:      
 
Domain Number - Region: 16-128,576-596
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.001
Family BAR domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000008751   Gene: ENSLAFG00000010440   Transcript: ENSLAFT00000010450
Sequence length 1360
Comment pep:novel supercontig:loxAfr3:scaffold_9:43168345:43217024:1 gene:ENSLAFG00000010440 transcript:ENSLAFT00000010450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELKVETRANVDWQKRCLALETQLFRFRLQASKIRELLADKMQELEQRLLEAEQRAENA
ETQVGVMEQKVKLSHLKNVDSAGSLHRKYQELMKVTQGKDELISQLEAQLEKQKQMRAEE
AKIVQEKAAKIKEWVTLKLAELEMENQHLQSCNQRLVEQVGALQDALEAVRMAPSGKLLV
APQETPEQMLSLQGPGKPADGDSGPQTEGFMKVGKGLYFFPGALQNKRSLEAGSPLDDSH
SSLVHSGERAEAKTPQGHLGREGSPGQLRVKPRIPRCGSTSWGEGLVSVQGGMLPGTKIS
IREGGPGSSLTLPKTRTPSTPQDSIHLAKRHHSQPQVGSGHFDHVVSIEIGALPALCPSS
LLEVKTGAELREEPEKMEMEEPPPAGKKEEQESLKIPGADLGEAELGNKPPTPPLHRFPS
WESRIYAVAISGMQLSDAAPRSNTASCASSPPALVFPGPFSGLVYKNVTVPVFTALKGRA
TKISSIPFVDESSGSDDDCSSQASFRTSVTCSEPRKTSGLGSPRAIKRGVSMSSLSSEGD
YAIPPDACSLDSDYSEPEHKLQRTSSYSTDGLSLGGKSGYLLKMGSRVKTWKRRWFVLRQ
RQIMYYKSPNDVIRKPQGQVELNSRCQIVRGEGAQTFQLISEKKTYYLTADSPSLLEEWI
RVLQSLLKVQAVGPPALPHSGTKPTVKGWLTKVKHGHSKLVWCALVGKTFYYYRSHEDKR
PLGHLPMRDAHIEEVDRSCDSDEDYEAGGTGRLLSSHCTLVIRPAEHSPTYLLIGTKHEK
DTWLYHLTVAAGGSSAKVGTAYEQLIGKLMDGEGDPDSPLWRHPVLCYSKDGLYTSLTTL
PSEALQTEALKLFKSCQLFINVPVEAASVDYHVSLAQTALQVCLVHPELQSEIYCQLMKQ
SNCRPPQKYSLMQCWQLLALCAPLFLPQHHFLWYIKQQLQRHADPRNETGQYATYCQRAV
ERTLQTGEREARPSRMEVVSILLRNPFHHSLPFSIPVHFANGTYQVVGFDGSSTVDEFLQ
RLNQETGMRKSSHSGFSLFTDDPSGRDLEHCLQGSVKICDVISKWEQALKELHPGKSEGG
TRIVKLMYKNRLYFRSQVKGETERERLLLASQTNGEIVAGRFPVNKELALEMAALMAQVE
YGDLEKPTLPGPGGTPPAKAQHLLQQVLDRFYPRRYRHGPPAEQLRHLADTLTTKWLALQ
GCSSPECIRIYLTVARKWPFFGAKLFTAQVMELSSKENTLVWIAVNEDGVSILDHNTMQV
HVTYPYSSVTTFGGCRDDFMLVIRSIQDQNSGKGHIEKLIFRMAAPKIAEATLIMASYMN
HCSATVSPPTNPPASRQPWELDGRQFFASIPRATKRPTLL
Download sequence
Identical sequences G3U556
ENSLAFP00000022964 ENSLAFP00000008751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]