SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000008993 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000008993
Domain Number 1 Region: 98-164
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000412
Family Ovomucoid domain III-like 0.00017
Further Details:      
 
Domain Number 2 Region: 191-239
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000707
Family Ovomucoid domain III-like 0.0086
Further Details:      
 
Domain Number 3 Region: 261-316
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000137
Family Ovomucoid domain III-like 0.0076
Further Details:      
 
Domain Number 4 Region: 27-65
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000569
Family TB module/8-cys domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000008993   Gene: ENSLAFG00000010749   Transcript: ENSLAFT00000010749
Sequence length 344
Comment pep:novel supercontig:loxAfr3:scaffold_7:55098525:55103752:1 gene:ENSLAFG00000010749 transcript:ENSLAFT00000010749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRPRHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGR
LSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAP
DCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCKKTCRDVYCPGSSTCV
VDQTNNAYCVTCNRICPEPTSSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCI
KAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPESKSDEPVCASDNATYASECAMKEA
ACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW
Download sequence
Identical sequences G3T668
ENSLAFP00000008993 ENSLAFP00000008993 XP_003408077.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]