SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000009008 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000009008
Domain Number 1 Region: 156-262
Classification Level Classification E-value
Superfamily C-type lectin-like 3.57e-39
Family Link domain 0.0059
Further Details:      
 
Domain Number 2 Region: 268-352
Classification Level Classification E-value
Superfamily C-type lectin-like 8.77e-24
Family Link domain 0.0028
Further Details:      
 
Domain Number 3 Region: 48-155
Classification Level Classification E-value
Superfamily Immunoglobulin 6.3e-16
Family V set domains (antibody variable domain-like) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000009008   Gene: ENSLAFG00000010769   Transcript: ENSLAFT00000010769
Sequence length 354
Comment pep:novel supercontig:loxAfr3:scaffold_7:87511656:87543309:-1 gene:ENSLAFG00000010769 transcript:ENSLAFT00000010769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSLLLLVLISVCWADDRSNNYTMDHNFLFLIIAENGPRLIVEAEQAKVFSRRGGNVTLP
CKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVSLKGDSDN
DASLVITDLTLEDYGRYKCEVIEGLEDDTSVVSLELQGVVFPYFPRLGRYNLNFHEAQQA
CLGQDAVIASFDQLYDAWRAGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGF
WDKDKSRYDVFCFTSNFNGRVYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKLLG
YDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN
Download sequence
Identical sequences G3T679
ENSLAFP00000009008 ENSLAFP00000009008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]