SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000009133 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000009133
Domain Number 1 Region: 35-359
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.47e-119
Family Bee venom hyaluronidase 0.0000101
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000009133
Domain Number - Region: 425-444
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00516
Family EGF-type module 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000009133   Gene: ENSLAFG00000010918   Transcript: ENSLAFT00000010917
Sequence length 475
Comment pep:novel supercontig:loxAfr3:scaffold_12:17219334:17221678:1 gene:ENSLAFG00000010918 transcript:ENSLAFT00000010917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAGPSPSVTLALMLAVAWATELKPTAPPIFTGRPFVVAWDVPTQDCGPRHKVPLDLKVF
DVQASPNEGWVNQNITIFYYDRLGLYPRFDSEGRSVHGGLPQNGSLPAHLKTLKAHVVHY
IRTQEPAGLAIIDWEDWRPVWVRNWQDKDVYRQLSRQVVANRHPDWPQDCVSKQAQYEFE
YAARQFMLETLRWVKAVRPRHLWGFYLFPDCYNHDYVQNWATYTGRCPDVEVARNDQLAW
LWAESTALFPSVYLDEILASSAHGRKFVSFRVQEALRVAHTHHANHALPVYVFTRPTYSR
GLTGLSEMDLISTIGESAALGAAGVILWGDAGYTTSTERITCRYFKNYLTQLLVPYVVNV
SWAAQYCSSAQCHGHGRCVRRDPSANAFLHLSTSSFRLVPGHGPGEPQLRPEGELSRADL
DHLQTHFRCQCYLGWGGEQCQWDHGKAAGGASQAWAGPHLPSLLALTALPLTWTL
Download sequence
Identical sequences G3TYG2
ENSLAFP00000020620 ENSLAFP00000009133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]