SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000009304 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000009304
Domain Number 1 Region: 41-91
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000103
Family EGF-type module 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000009304   Gene: ENSLAFG00000011117   Transcript: ENSLAFT00000011119
Sequence length 241
Comment pep:novel supercontig:loxAfr3:scaffold_4:40247743:40279487:1 gene:ENSLAFG00000011117 transcript:ENSLAFT00000011119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMFVLRLRVNSSAQITLAECCTCYPGYRYDRERHRKREKPYCLDIDECANSNETLCAHIC
INTLGSYRCECREGYIQEDDGKTCTKADKYPNDTGLDEKAKNAVQAGTCCASCKEFHQMK
QTVLQLKQKIALLPNNAADLGKYITGDKVLASNTYLPGPPGLPGDQGPPGSPGPKGSPGF
PGMPGPPGQPGPRGSMGPMGPSPDLSHIKQGRRGPVGPPGAPGRHGLKGERGAPGPRGSP
V
Download sequence
Identical sequences G3T6X0
ENSLAFP00000009304 ENSLAFP00000009304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]