SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000009433 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000009433
Domain Number 1 Region: 80-283
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.08e-43
Family Reprolysin-like 0.0036
Further Details:      
 
Domain Number 2 Region: 381-437
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000968
Family TSP-1 type 1 repeat 0.00047
Further Details:      
 
Domain Number 3 Region: 1007-1068
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000011
Family TSP-1 type 1 repeat 0.0078
Further Details:      
 
Domain Number 4 Region: 683-742
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000693
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000009433
Domain Number - Region: 899-948
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00101
Family TSP-1 type 1 repeat 0.0072
Further Details:      
 
Domain Number - Region: 1192-1273
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0044
Family Spermadhesin, CUB domain 0.0098
Further Details:      
 
Domain Number - Region: 948-979
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0589
Family TSP-1 type 1 repeat 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000009433   Gene: ENSLAFG00000011278   Transcript: ENSLAFT00000011282
Sequence length 1407
Comment pep:novel supercontig:loxAfr3:scaffold_88:230725:264291:-1 gene:ENSLAFG00000011278 transcript:ENSLAFT00000011282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGLPCWGRLPPLCKASLGGLLTAAFFLLGCCGLSNLQQRFLQALEPVEVASYLGPGSAV
KGGPPSPHLQRQTRAVGNVLHLELLVAVGPDVHQAHQEDTERYVLTNLNIGSELLRDPSL
GAQFRVHLVKMIVLTEPEDAPNITANITSSLLSVCDWSRAVNPADDTDPGHADLVLYITR
FDLELPNGDRKVRGVTQLGGVCSSSWSCLITEDTGFDLGVTIAHEIGHSLGLEHDGAPTC
GSSSHVMAADVAASARRRPAWSACSRQQLRHLLSAGRARCLWDPPRPQPEPAGLLLEAQP
GLYYSADEQCRVAFGRTAVACTFAKESLDVCQALSCHTDPLDHSSCSRLLIPLLDGTECG
VDKWCSRGHCRSLAELSPLPAVHGHWSSWGAPSPCSRSCGGGVATRRRQCNNPRPAFGGR
ACTGADLQAELCNTQACRTSQLEFMSEQCAQTEGQPLLLPEGGSTFYRWSSAVQYSQAGD
SLCRYMCWAVGENFIVRRGDSFVDGTRCVPSGPREDGTFSLCLSGRCRILGCDGRMDSQQ
VRDVCQVCGGDNSTCSPHNGSFSGGRAREYVTFLTVTPNLTSVYVVNRRPLFTHLAVRIR
GRYVVAGNGSVSPSTTYPSLLEDSRLEYRVALTEDQLPHREELHIQGPTQEDIEIQVYRR
YSEEYGSLAHPDITFSYFQPKQLHVGMWAAVWGSCSVSCGAGQRWVTYGCLDQAQNKWVE
AAQCEGSPKPPERSEPCAPMPCPARSAGGLTPANTLTEGASSSHSLRVLLTQPQNPPDTA
SASSSHSFRVLLNTASESSSHSFRVAQSPPHTASESSSHSLRVLNRTCVPQAEGQEALGD
AGPCSTDEEPPALAPCFGMACHQGWDHLDVTTPGEEAPSPLGSAGPGALAAHAWIPLSGP
CSVSCGQGLRELRSVCVDPIRGTAVPEELCDPATRPRNQREACQVALCPARWETRALGPC
PVTCGGGQVPLAMHCVRPDHGRTIPLPHAKCGRLPQPRPLVCCSWFHSPCRWRVLPPGPC
SASCGLGTAQRLVTCVRLDRGLEIELDEVACAGLERPQATIPCLLADCAYRWHVSTWTEW
ALSMGEPRALIHGTPEGGESPCPPPQVLGCSVAQSRPHPVCRLVMCWVCSGGSWGASRQR
GMRPGDLGGWSKGAPGSRHLNSRQMSERNQVLGGQSYTGSGPSGAQGLTLSGICGRQFLE
PAGTIDLRGPGQAECVVAIGRPLGEVVTLYVLHSRFLGETLLLWSRLTWRKLCGKLAGTI
FSSQANTLVVRQRRVRPDGGLVLQYRGRPAQHPSHRECDMQLFGPRGEIVGPSLRPDGRS
AGGCRVFIDVAPQARMAIHALVTNVGMQTKGTEASYILIRDIHSLRTSTFRGQQSFYWES
AGSQAEVELSEGFLEARASLRGQYWTL
Download sequence
Identical sequences G3T776
ENSLAFP00000009433 ENSLAFP00000009433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]