SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000009481 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000009481
Domain Number 1 Region: 116-178
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000417
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 2 Region: 263-322
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000306
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 3 Region: 78-126
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000278
Family Complement control module/SCR domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000009481   Gene: ENSLAFG00000011346   Transcript: ENSLAFT00000011346
Sequence length 465
Comment pep:novel supercontig:loxAfr3:scaffold_78:449319:473732:-1 gene:ENSLAFG00000011346 transcript:ENSLAFT00000011346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHQLTQIRALSLLLFLTPAVTPTWYAGSGYYPDESYNEVYAEEVPRVPALDYRVPRWCY
TLNIQDGEATCYSPRGGNYHSSLGTRCELSCDRGFRLIGRRSVHCLPSRRWSGTAYCRQM
RCHALPLITSGTYTCTNGVLLDSRCDYSCSSGYYLEGDRSRICMEDGRWSGGEPVCVDID
PPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRGPEPGSHFPEGEHVIR
YTAYDRAYNRASCKFIVKVQVRRCPTLKPPQHGYLTCTSAGDNYGAICEYHCDGGYERQG
TPSRVCQSSRQWSGSPPICAPMKINVNVNSAAGLLDQFFEKRRLLIISAPDSSNRYYKMQ
ISMLQQSTCGLDLRHVTIIELVGQSPQEVGRIREQQLSANIIEELRQFQRLARSYFNMVL
IDKQGIDRERYMEPVTPEEIFTFIDDYLLSDQELTQRREQRDICE
Download sequence
Identical sequences G3T7B5
XP_003420070.1.64505 ENSLAFP00000009481 ENSLAFP00000009481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]