SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000009596 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000009596
Domain Number 1 Region: 61-123
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000337
Family Complement control module/SCR domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000009596   Gene: ENSLAFG00000011485   Transcript: ENSLAFT00000011485
Sequence length 324
Comment pep:novel supercontig:loxAfr3:scaffold_9:45405137:45453539:1 gene:ENSLAFG00000011485 transcript:ENSLAFT00000011485 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCYGRIAPKSTSAFAVASVGHGVFLPLVILSTLLGDGLASGESPPAFCVWGECTIALFVF
AVCPRPPEPENGGYICHPRPCRDPLTAGSVIEYLCAEGYMLKGDYKYLTCKNGEWKPAME
ISCHLNEDKDAHTSLGAPTLSIVASTASSVALILLLVVLFVLLQPKLKSFHHSRRDQGVS
GDQVSIMVDGVQVALPSYEEAVYGCSGHCVPPADPRVQIVLSEGSEPSGRSMPREQQLQD
QGACSFAGGEDEAPGHSGLCEAWGSRGSETVMVHQATTSSWVAGSGNSHPTHKEAPDSES
SDIQSLLSLTSEEYTDDIPLLKEA
Download sequence
Identical sequences G3T7K6
ENSLAFP00000009596 ENSLAFP00000009596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]