SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000009598 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000009598
Domain Number 1 Region: 4-133
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.86e-19
Family Laminin G-like module 0.069
Further Details:      
 
Domain Number 2 Region: 379-523
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000000611
Family Matrix metalloproteases, catalytic domain 0.092
Further Details:      
 
Domain Number 3 Region: 1212-1251
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000133
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 4 Region: 535-573,757-801
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000525
Family Fibronectin type III 0.0061
Further Details:      
 
Domain Number 5 Region: 1173-1218
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000639
Family Complement control module/SCR domain 0.0073
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000009598
Domain Number - Region: 283-306
Classification Level Classification E-value
Superfamily Notch domain 0.00157
Family Notch domain 0.0044
Further Details:      
 
Domain Number - Region: 1101-1155
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0374
Family Complement control module/SCR domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000009598   Gene: ENSLAFG00000011481   Transcript: ENSLAFT00000011487
Sequence length 1262
Comment pep:novel supercontig:loxAfr3:scaffold_16:24480837:24684213:-1 gene:ENSLAFG00000011481 transcript:ENSLAFT00000011487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVFDNCSHTASDKGWALGIRSGKDKGRRDARFFFSLRTDHVKKATVVTGRSRYQPGMWTH
VAATYNGRRMALYVDGTQVASSSDQSGPLNSPFMVSCRSLLLGGDNSDHGHYFRGHLGTL
AFWSMALPQSHLQHSLKHSSEAEELTTLILTASFEPLEEQWVPFRDEKFPRLEILQGFEM
APEILSPLQPPLCGQTACDNVELITQYNGHWPLRGEKVMRYQVVNICDDEGLNPTVSEEQ
INRQHEALDQAFSRYNISWQLSIRQVHNSTLRHRVVLVNCEPSKIGNDHCDPECEHPLTG
YDGGDCRLQGRCYSWNRRDGLCHVECNNMLNDFDDGDCCDPEVANVRKTCFDPDSPKRAY
MSVKELKEALQLNGTHFLNVYFASSVREDLAGAATWPWDKEATSHLGGVVLNPAYYGMPG
HTNIMIHEVGHVLGLYHVFKGVSERESCDDPCRETVPSMDTGDLCADTPPTPKSKLCQDP
EPTNDTCGFTHFPGAPFSNYMSYTDDDCTDSFTPNQVARMHCYLDLVYQQWSQSRKPTPI
PIPPMVIGQTHKSLTIYWLPPISGVVYDRDPGSLCGACTEDGTFRQYVHTASSRRVCDSS
GYWTPEEAVGPPDVDQPCEPSLQAWSPELHLYHMNMTVPCPTEGCSLELLFKHPVHADML
TLWVTYLSMDSSQALFDTEILLENQESVHLGPLNTFCDIPLTIKLHVDGKVLGVKVYTLD
ERMEIDAALLTSQPHSSLCSGCRPVRYQVLREPPFATGLPMVVTHPHRKFTDVEVTPGRT
YQYQVQAEAGAELGEPSPPLIHMHGAPYCGDGKVAEGLGEQCDDGDLLSGDGCSRTCKLE
EGFNCVGEPSLCYIYEGDGICESFEKETSILDCGLYTPKGYLDQWATQAYSSHEDKKKCP
VSLVTGEPHSMICTSYHPDLPEHRPLTGWFPCATSFSYYTVDSRSFYRYCLMVCFNRPGV
ATAIFIFLTSDGLVPGEHQRPTVTLQLTDVSGRNHSLGTYELSCQHNPLVINVTHHQNVL
SHRTTSMLLNFSSPMVGISAVALRTSSHISPAAPNNCIPEHKGQDYQGQSCVHQPCGEQG
SCAPLLLDHMDVVNCTSGGPGHMKCAVTCERGFALQARNGQYLKPMQIKKEILLTCSSGH
WDRAVSCVPLDCGIPDQSLVNYANFSCLEGTGFLKRCSISCVPPAKLQGLNPWLTCLEDG
LWSLPEVYCKLECDAPPAVPNANLLLPHCLQGNHDVGSVCRYECKPGYYVVESAEKKKKK
TF
Download sequence
Identical sequences G3T7K8
ENSLAFP00000009598 ENSLAFP00000009598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]