SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000009828 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000009828
Domain Number 1 Region: 3-135
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.59e-41
Family Galectin (animal S-lectin) 0.00000091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000009828   Gene: ENSLAFG00000011761   Transcript: ENSLAFT00000011761
Sequence length 136
Comment pep:novel supercontig:loxAfr3:scaffold_99:1949295:1951271:-1 gene:ENSLAFG00000011761 transcript:ENSLAFT00000011761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQTIPHKTSLPQGIHAGTVLRIRGLVPHNAGRFHVNLLCSEGQDADAALHFNPRMDTSEV
VFNSKEQGAWGPEERGKGVPFYRGQPFEVLLIATDDGFKAVVGDSEYHVFRHRMPLARVR
LLEVGGDVQLESVRVF
Download sequence
Identical sequences G3T845
ENSLAFP00000009828 ENSLAFP00000009828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]