SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000010057 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000010057
Domain Number 1 Region: 185-327
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-39
Family Third domain of FERM 0.00041
Further Details:      
 
Domain Number 2 Region: 85-187
Classification Level Classification E-value
Superfamily Second domain of FERM 4.32e-26
Family Second domain of FERM 0.00017
Further Details:      
 
Domain Number 3 Region: 3-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.44e-22
Family First domain of FERM 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000010057   Gene: ENSLAFG00000012032   Transcript: ENSLAFT00000012031
Sequence length 711
Comment pep:novel supercontig:loxAfr3:scaffold_100:1816007:1887010:-1 gene:ENSLAFG00000012032 transcript:ENSLAFT00000012031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHLKVQFLDDSQKIFVVDQKSSGKALFNLSCSHLNLAEKEYFGLEFCSHSGNKVWLELL
KPITKQVKNPKEVVFKFMVKFFPVDPGHLREELTRYLFTLQIKKDLALGKLPCSDNCTAL
MVSHILQSELGDFHEETDRKHLAQTRYLPNQDCLESKILHFHQKHIGRSPAESDILLLDI
ARKQDMYGIRPHPASDGEGMQIHLAVAHMGVLVLRGNTKINTFNWAKIRKLSFKRKHFLI
KLHANILVLCKDTLEFTMASRDACKAFWKTCVEYHAFFRLSEEPKSKPKTLLCSKGSSFR
YSGRTQRQLLEYGKKGKLKSLPFERKHYPSQYHERQCRSSPDLLSDVSKQVEDLRLAYGS
GCYRNANGVHASEPVLDSRRRNSAVEVTFAAKLERSKPEADPISLHQSQSSSSFHFMYTD
PVFNTDPDPDTDFFEERSPLSSFQTSCKFANNHMSTSSGLTSKVSPARQLTYTDVPYIPC
TSQQVDIMPPQVFFYVDRPPQVPRRSPIMAEERERPDSCLQPSVMKPAKRSPRNIRMKSF
QQDFQELQEAMARTSGRSNINVDLEDEDPTLVDAFAYNIQGQTPKRSQSHSDMKTIRFPF
GSEFRPLGPCPALSRKADLLTYMFAEQEFPTALVGQGAADRYVASESSDSESEILNPDYY
SLYGKGTKSPTARIRLSSGSLQLDEEDEDASFNASTAEDRTLLKPCNYFLA
Download sequence
Identical sequences G3T8N0
ENSLAFP00000010057 ENSLAFP00000010057 XP_010598719.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]