SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000010110 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000010110
Domain Number 1 Region: 109-268
Classification Level Classification E-value
Superfamily C-type lectin-like 2.45e-33
Family C-type lectin domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000010110   Gene: ENSLAFG00000012092   Transcript: ENSLAFT00000012093
Sequence length 276
Comment pep:novel supercontig:loxAfr3:scaffold_15:55260206:55273154:-1 gene:ENSLAFG00000012092 transcript:ENSLAFT00000012093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEEVTYATLTFQNSAETGNNRNQNNRRKRGYPAPSPIWRQASLSLLTLCLILLIGLVTL
GILYLQASNEINSDSEKLSRLQKTVHQKQDNSSQQLGNYGNFSMEEDFLKSQISNLLKKQ
GQMAIKLCQQLIIHNSDHECNPCPKMWQWYQNSCYYFTTNEEKTWINSRKDCMDKNSTLL
KIDSLEEKDFLKSQPLPKLSFFWLGLSWDPFGRSWLWEDGSTPSASIFSTKELTQFNGSK
GCAYFQKGNIYISRCSAEISWICEKTAALVKTEDLK
Download sequence
Identical sequences G3T8S4
XP_003410868.1.64505 ENSLAFP00000010110 ENSLAFP00000010110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]