SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000010166 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000010166
Domain Number 1 Region: 22-66
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000268
Family Laminin-type module 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000010166
Domain Number - Region: 123-174
Classification Level Classification E-value
Superfamily Cytochrome c oxidase subunit II-like, transmembrane region 0.085
Family Cytochrome c oxidase subunit II-like, transmembrane region 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000010166   Gene: ENSLAFG00000012164   Transcript: ENSLAFT00000012163
Sequence length 224
Comment pep:novel supercontig:loxAfr3:scaffold_6:38680796:38683044:1 gene:ENSLAFG00000012164 transcript:ENSLAFT00000012163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGWNCNKCENGYYNSDSICIKCQCHDHVDPVKTPKICKPESGECINCLHNTTGFWCENCL
EGYVRDLEGNCIKKEVIVPTPEGSTILVSNASLTTSVPTPVINSTFTPTTLQTIFSVSSS
ENSTSALADVSWTQFNIIILTVIIIVVVLLMGFVGAVYMYREYQNRKLNAPFWTIELKED
NISFSSYHDSIPNADVSGLLEDDGNEVAPNGQLTLTTPMHNYKA
Download sequence
Identical sequences G3T8W7
ENSLAFP00000010166 ENSLAFP00000010166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]