SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000010242 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000010242
Domain Number 1 Region: 74-128
Classification Level Classification E-value
Superfamily L domain-like 0.0000875
Family Internalin LRR domain 0.077
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000010242
Domain Number - Region: 162-194
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00405
Family EGF-type module 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000010242   Gene: ENSLAFG00000012256   Transcript: ENSLAFT00000012257
Sequence length 230
Comment pep:novel supercontig:loxAfr3:scaffold_20:40892009:40896012:1 gene:ENSLAFG00000012256 transcript:ENSLAFT00000012257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QMARRRPGGPTSLVLCATALLLALGVERALALPEICIQCPGSVQNLSEVALFCKQTPKLM
LYARCCFNQKGAILGLDLQNCSLKDPGPNFPQAHTAIIIDLQANPLKDDLVNTFHGFTQL
QTLILPQNVSCPGGISAWNTITTHTDKQTCQGQRNLCNSTGSPEMCPENGSCAPNGPGLL
QCLCADGFHGYKCMRQGSFSLIVFFGILGSTTVSIRILLWETQRRKAKSS
Download sequence
Identical sequences G3T922
ENSLAFP00000010242 ENSLAFP00000010242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]