SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000010285 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000010285
Domain Number 1 Region: 9-70
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000128
Family Complement control module/SCR domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000010285   Gene: ENSLAFG00000012304   Transcript: ENSLAFT00000012302
Sequence length 238
Comment pep:novel supercontig:loxAfr3:scaffold_107:1741658:1747793:-1 gene:ENSLAFG00000012304 transcript:ENSLAFT00000012302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPVFSSLGTCSQVKPPPQGTFRVLRGNGTSVGTVLLFQCPSGHQMGGPGLVTCAWKGSVA
EWSSGTPVCKSMPLYETFGFRVAVIASIVSCAIILLMSMAFLTCCLMKCVKRTEQQRSDR
TAQLWYQLRGKDLETVQAAYLSLKGLNNNNNSHPSSHPRLGEAAVQAHDNHCFTTDHAKG
TRELASMGPSVNKDPWTPAPDALNPSVSSSLPHTQVMVHIESLVQTLPASGPTLEMPG
Download sequence
Identical sequences G3T958
ENSLAFP00000010285 ENSLAFP00000010285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]