SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000010353 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000010353
Domain Number 1 Region: 137-198
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.75e-23
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000010353
Domain Number - Region: 47-119
Classification Level Classification E-value
Superfamily Tropomyosin 0.00288
Family Tropomyosin 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000010353   Gene: ENSLAFG00000012382   Transcript: ENSLAFT00000012382
Sequence length 210
Comment pep:novel supercontig:loxAfr3:scaffold_91:586679:587990:-1 gene:ENSLAFG00000012382 transcript:ENSLAFT00000012382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QCPPASDPERDRQTGDQRPSTPSLPQLTAEKSSYLYSTEITLWTVVAAIQALEKKVDSCL
SRLLTLEGRTGMAEKKLADCERTAMEFGNQLEGKWAMLGTLLQEYGLLQRRLENTENLLR
NRNFWILRLPPGSKGEVPKVPVTFDDVAVYFSEQEWGKLDEWQKELYKHVMRGNYETLVS
LDYAISKPDILTQIERGEEPCPEDQWGQEK
Download sequence
Identical sequences G3T9A7
ENSLAFP00000010353 ENSLAFP00000010353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]