SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000010449 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000010449
Domain Number 1 Region: 1346-1573
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.46e-39
Family Laminin G-like module 0.003
Further Details:      
 
Domain Number 2 Region: 391-503
Classification Level Classification E-value
Superfamily Cadherin-like 1.1e-30
Family Cadherin 0.00053
Further Details:      
 
Domain Number 3 Region: 1596-1789
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-29
Family Laminin G-like module 0.037
Further Details:      
 
Domain Number 4 Region: 491-604
Classification Level Classification E-value
Superfamily Cadherin-like 1.11e-28
Family Cadherin 0.00067
Further Details:      
 
Domain Number 5 Region: 807-919
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-28
Family Cadherin 0.00061
Further Details:      
 
Domain Number 6 Region: 281-389
Classification Level Classification E-value
Superfamily Cadherin-like 1.41e-26
Family Cadherin 0.00068
Further Details:      
 
Domain Number 7 Region: 176-287
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-26
Family Cadherin 0.00095
Further Details:      
 
Domain Number 8 Region: 907-1021
Classification Level Classification E-value
Superfamily Cadherin-like 6.85e-26
Family Cadherin 0.0009
Further Details:      
 
Domain Number 9 Region: 698-802
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-25
Family Cadherin 0.0012
Further Details:      
 
Domain Number 10 Region: 601-702
Classification Level Classification E-value
Superfamily Cadherin-like 8.57e-22
Family Cadherin 0.00095
Further Details:      
 
Domain Number 11 Region: 1015-1117
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000228
Family Cadherin 0.0079
Further Details:      
 
Domain Number 12 Region: 1286-1325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000126
Family EGF-type module 0.013
Further Details:      
 
Domain Number 13 Region: 1922-1962
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000393
Family Laminin-type module 0.0094
Further Details:      
 
Domain Number 14 Region: 1793-1827
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000303
Family EGF-type module 0.01
Further Details:      
 
Domain Number 15 Region: 1828-1874
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000312
Family EGF-type module 0.0099
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000010449
Domain Number - Region: 1265-1290
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00216
Family EGF-type module 0.067
Further Details:      
 
Domain Number - Region: 2424-2637
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00687
Family Rhodopsin-like 0.015
Further Details:      
 
Domain Number - Region: 1573-1603
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00754
Family EGF-type module 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000010449   Gene: ENSLAFG00000012495   Transcript: ENSLAFT00000012501
Sequence length 2919
Comment pep:novel supercontig:loxAfr3:scaffold_11:54042990:54066351:1 gene:ENSLAFG00000012495 transcript:ENSLAFT00000012501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAARAPLPTPLPLPLLLLLLLLSPPPLLGDQVGPCRSLGSGGRGSSGACAPVGWLCPASS
SNLWLYTSRCRAAGTELTGHLVPHHDGLRVWCPESGAHIPLPPAPEGCPWSCRLLGIGGH
LSPQGKLTLPHEHPCLKAPQLRCQSCKLAQTPGQGTGEGSAGESMGGRRKRNVNTAPQFQ
PPSYQATVPENQPAGTPVASLRAIDPDEGEAGRLEYTMDALFDSRSNHFFSLDPVTGAVT
TAEELDRETKSTHVFRVTVQDHGMPRRSALATLTILVTDTNDHDPVFEQQEYKESLRENL
EVGYEVLTVRATDGDAPPNANILYRLLEGPGGNPSEVFEIDPRSGVIRTRGPVDREEVES
YQLTVEASDQGRDPGPRSATAAVFLSVEDDNDNAPQFSEKRYVVQVREDVAPGAPVLRVT
ASDRDKGSNALVHYSIMSGNARGQFYLDAQTGALDVVSPLDYETTKEYTLRVRAQDGGRP
PLSNVSGLVTVQILDINDNAPIFVSTPFQATVLESVPLGYLVLHVQAIDADAGDNARLEY
RLAGVGHDFPFSINNGTGWISVAAELDREEVDFYSFGVEARDHGTPALTASASVSVTILD
VNDNNPTFTQPEYTVRLNEDAAVGTSVVTVSAVDRDAHSVITYQITSGNTRNRFSITSQS
GGGLVSLALPLDYKLERQYVLAVTASDGTRQDTAQVVVNVTDANTHRPVFQSSHYTVNVN
EDRPAGTTVVLISATDEDTGENARITYFMEDSIPQFRIDADTGAVTTQAELDYEDQVSYT
LAITARDNGIPQKSDTTYLEILVNDVNDNAPQFLRDSYQGSVYEDVPPFTSVLQISATDR
DSGLNGRVFYTFQGGDDGDGDFIVESTSGIVRTLRRLDRENVAQYTLRAYAVDKGMPPAR
TPMEVMVTVLDVNDNPPVFEQDEFDVFVEENSPIGLAVARVTATDPDEGTNAQIMYQIVE
GNIPEVFQLDIFSGELTALVDLDYEDRPEYILVIQATSAPLVSRATVHVRLLDRNDNPPV
LGNFEILFNNYVTNRSSSFPGGAIGRVPAHDPDISDSLTYSFERGNELSLVLLNASTGEL
RLSRALDNNRPLEAIMSVLVSDGVHSVTAQCALRVTIITDEMLTHSITLRLEDMSPERFL
SPLLGLFIQAVAATLATPPDHVVVFNVQRDTDAPGGHILNVSLSVGQPPGPGGGPPFLPS
EDLQERLYLNRSLLTAISAQRVLPFDDNICLREPCENYMRCVSVLRFDSSAPFIASSSVL
FRPIHPVGGLRCRCPPGFTGDYCETEVDLCYSRPCGSHGRCRSHEGGYTCLCREGYTGEH
CEVSARSGRCTPGVCKNGGTCVNLLVGGFKCDCPSGDFEKPYCQVTTRSFPARSFITFRG
LRQRFHFTLALSFATRERNGLLLYNGRFNEKHDFVALEVIQEQVQLTFSAGESTTTVSPF
VPGGVSDGQWHTVQLKYYNKPLLGQTGLPQGPSEQKVAVVTVDGCDTGVALRFGAVLGNY
SCAAQGTQGGSKKSLDLTGPLLLGGVPDLPESFPIRTRHFVGCMRNLQVDSRHVDMANFI
ANNGTVPGCLAKKNVCDSNTCHNGGTCVNQWDAFSCECPLGFGGKSCAQEMASPQRFLGS
SMVVWHGLSLPISQPWHLSLMFRTRQANGVLLQAVTRGRSTITLQLREGHVVLSVEGTGL
QASSLWLDPGRANDGDWHHAQLALGASGGPGHAILSFDYGQQQTEGNLGPRLHGLHLSNI
TVGGVPGPASGVARGFRGCLQGVRVSETTEGVSSLDPSLGESINVEPGCSLPDPCDSNPC
PANSYCSDDWDSYSCSCDPGYYGDNCTNVCDLNPCEHQSVCTRKPNAPHGYTCECPQNYL
GPYCETRIDQPCPRGWWGHPMCGPCNCDVSKGFDPDCNKTSGECHCKENHYRPPGSPTCL
LCDCYPTGSLSRVCDPEDGQCPCKPGVIGRQCDRCDNPFAEVTTNGCEVNYDSCPRAIEA
GIWWPRTRFGLPAAAPCPKGSFGTAVRHCDEHRGWLPPNLFNCTSVTFSELKGFAERLQR
NESGLDSGRSQRLALLLRNATQHTAGYFGSDVKVAYQLATRLLAHESTQRGFGLSATQDV
HFTENLLRVGSALLDAANKRHWELIQQTEGGTAWLLQHYEAYASALAQNMRHTYLSPFTI
VTPNIVISVVRLDKGNFAGAKLPRYEALRGERPPDLETTVILPESVFREMPPAVRPAGPG
EAQEPEELARRQRRHPELSQGEAVASVIIYRTLAGLLPHNYDPDKRSLRVPKRPVINTPV
VSISVHDDEELLPRALDKPVTVQFRLLETEERTKPICVFWNHSILVSGTGGWSARGCEVV
FRNESHVSCQCNHMTSFAVLMDVSRRENGEILPLKTLTYGALGVTLAALLLTFVFLTALR
TLRSNQHGIRRNLTAALGLAQLVFLLGINQADLPFACTVIAILLHFLYLCTFSWALLEAL
HLYRALTEVRDVNAGPMRFYYMLGWGVPAFITGLAVGLDPEGYGNPDFCWLSIYDTLIWS
FAGPVAFAVSMSVFLYILAARASCAAQRQGFEKKGPVSGLRPSFAVLLLLSAAWLLALLS
VNSDTLLFHYLFAACNCIQGPFIFLSYVVLSKEVRKALKFACSRKPSPDPALTTKSTLTS
SYNCPSPYADGRLYQPYGDSAGSLHSASRSGKSQPSYIPFLLREESTLNPGQGPPGLGDP
GSLFMEGQDQQHDPDTDSDSDLSLEDDQSGSYASTHSSDSEEEAEEEEAAFPGEPGWDSL
LGPGAERLPLHSTPKDGGPGPGKAPWPGDFGTTTKESGGSGAPEERLRENGDALSREGSL
GPLPGPSAQPHKGILKKKCLPTISEKSSLLRLPLEQGTASSRCSSASEGSRGGPPPRPPP
RQSLQEQLNGVMPIAMSIKAGTVDEDSSGSEFLFFNFLH
Download sequence
Identical sequences G3U950
ENSLAFP00000010449 ENSLAFP00000024358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]