SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000010601 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000010601
Domain Number 1 Region: 5-299
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.41e-83
Family Eukaryotic proteases 0.0005
Further Details:      
 
Domain Number 2 Region: 431-542
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-28
Family Spermadhesin, CUB domain 0.00078
Further Details:      
 
Domain Number 3 Region: 316-420
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-22
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000010601   Gene: ENSLAFG00000012678   Transcript: ENSLAFT00000012676
Sequence length 568
Comment pep:novel supercontig:loxAfr3:scaffold_21:42706981:42730766:1 gene:ENSLAFG00000012678 transcript:ENSLAFT00000012676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAISRNKLVLLLGIICLEQGKSATLSLPKAPTCGRSLVKPHHWNYLNIFSRIVGGSQVEK
GSYPWQVSLKRRQKHICGGTIISPQWVITAAHCVANRNIASTLNVTAGEYDLSQREPGEQ
TLTIETIIIHPYFTTKKPMDYDIALVKMAGTFHFGQFVGPLCLPEPGERFEAGFICTAAG
WGRLTEGGLLSQVLQEVNLPILTQEECTMALLTLKKPISGQTFLCTGFPDGGRDACQGDS
GGSLMCQNKKGTWTLAGVTSWGLGCGRGWRNNVEKNDQGSPGIFTDLSKVLPWIHGHIRT
GKRRNSSRASCSEQDGVVSGPEGELHFPESPHLYYESNQLCVWTLLVPEKMHVLLSFSHL
DVESCHHNYLSIHSLGDRLIGKLCEEGLFSSVHIGSNSIRLKFISDATDYAAGFNLTYKA
LKPNYLPDSGCDSLVVLFEESLIQSLHYPENYSNMANCNWIFQAPKHYLIKLSFQSLEIE
ESGDCTSDYVTVHRDVERKKEIARLCGFAVPAPVLSSSSVMFISFQSDENMSFRGFQATV
SFISEADLNISTSADESVLLENTWNMLP
Download sequence
Identical sequences G3T9V5
ENSLAFP00000010601 ENSLAFP00000010601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]