SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000010700 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000010700
Domain Number 1 Region: 2-262
Classification Level Classification E-value
Superfamily C-type lectin-like 6.64e-94
Family Sulfatase-modifying factor-like 0.000000000273
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000010700   Gene: ENSLAFG00000012794   Transcript: ENSLAFT00000012796
Sequence length 272
Comment pep:novel supercontig:loxAfr3:scaffold_45:10671625:10681659:1 gene:ENSLAFG00000012794 transcript:ENSLAFT00000012796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVQLPGGRFQMGTDSPDGRDGEGPVREVTVKPFAIDIFPVTNKDFREFVRANKYRTEAES
FGWSFVFEDFVSDELRKKATHQMKSLLWWLPVEKAFWRQPAGPGSGIRERLELPVLHVSW
NDARAYCAWRGKRLPTEEEWEFAARGGLKGQVYPWGNRFQPNRTNLWQGKFPKGDRAEDG
FHGVSPVNAFPPQNNYGLYDLMGNVWEWTASPYQPASQDMRVLRGASWIDTADGSANHRA
RVTTRMGNTPDSASDNLGFRCASSAGRPRGEL
Download sequence
Identical sequences G3TA36
ENSLAFP00000010700 ENSLAFP00000010700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]