SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000010717 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000010717
Domain Number 1 Region: 548-697
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.9e-62
Family Ankyrin repeat 0.0000127
Further Details:      
 
Domain Number 2 Region: 32-266,303-328
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.74e-43
Family BAR domain 0.024
Further Details:      
 
Domain Number 3 Region: 431-546
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.31e-36
Family Pyk2-associated protein beta ARF-GAP domain 0.0000112
Further Details:      
 
Domain Number 4 Region: 306-411
Classification Level Classification E-value
Superfamily PH domain-like 5.51e-20
Family Pleckstrin-homology domain (PH domain) 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000010717   Gene: ENSLAFG00000012812   Transcript: ENSLAFT00000012816
Sequence length 907
Comment pep:novel supercontig:loxAfr3:scaffold_34:1537422:1583103:-1 gene:ENSLAFG00000012812 transcript:ENSLAFT00000012816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEQLSVAEFLAITAEDLSSPAGAVAFAAKMPRCRGAALAREESLEGDQAILQRIKKSVR
AIHSSGLGHVENEEQYREAVESLGNSHLSQNSHELSTGFLNLAVFTREVAALFKNLVQNL
NNIVSFPLDSLLKGQLRDGRQDSKKQLDKAWKDYEAKTAFYQMERVSTRFPEGGLSIHSM
GTCKDHCVFSLCGCPYYLLKAGESQVKQGPDFLQSLVKFFHAQHNFFQDGWKAAQSLSPF
IEKLAASVHTLRQAQEEELQKLTQLRDSLRGTLQLQNREEQETVGRKNSGGGYSIHQHQG
NKQFGTEKVGFLYKKSPRIRRVWQKRKCGVKYGCLTISHSTINRPPVKLTLLTCQVRPNP
EEKKCFDLVTHNRTYHFQTEDEHECEAWVSVLQNSKDEALSSAFLGEPSSGPGPCGGAGL
DGEPRDLTKLLIAEVKSRPGNGQCCDCGAPDPTWLSTNLGVLTCIQCSGVHRELGVRFSR
MQSLTLDLLGPSELLLALNIGNTHFNEIMEAQLPSHGGSKPSAESDMSPRRDYIVAKYVE
HRFARRSTLEPQRLWTAIYNRDLLSVLEAFANGQDFGQTLPGPDGQAPGELALHLAVRVA
NQASLPLVDFIIQNGGHLDAKAPDGNTALHYAALHNQPDCLKLLLKGRASVSAVNEAGET
ALDVARKKQHKECQELLEQAQAGTLTFPLHVDYSWGISVEPGSDSEEDEEEKRYPLKLPA
QARWSSGRQDISNKTYEAIASLGSATPRSQNEDFPPPLPVKNPSRTMVQGRVGHASGDCS
EAPSLSSEPPGTPESLRSPASSSSSLTSPVEPGGPSQALPGSEESLQEPLGTTRPSLLPG
NTPAEMYPPVRFSSESTRSYRRGGRNLEDSPSARRPLPRRNMPVGFTEGDGSRTGVLPAS
SVQLLQD
Download sequence
Identical sequences G3TA51
ENSLAFP00000010717 ENSLAFP00000010717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]