SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000010772 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000010772
Domain Number 1 Region: 348-401
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000248
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 2 Region: 987-1037
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000067
Family Laminin-type module 0.005
Further Details:      
 
Domain Number 3 Region: 939-989
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000142
Family Laminin-type module 0.031
Further Details:      
 
Domain Number 4 Region: 784-826
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000363
Family Laminin-type module 0.0086
Further Details:      
 
Domain Number 5 Region: 878-930
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000544
Family Laminin-type module 0.0082
Further Details:      
 
Domain Number 6 Region: 832-880
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000193
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 7 Region: 523-562
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000243
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 8 Region: 284-350
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000307
Family Laminin-type module 0.052
Further Details:      
 
Domain Number 9 Region: 471-515
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000279
Family Laminin-type module 0.0085
Further Details:      
 
Domain Number 10 Region: 1144-1192
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000162
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 11 Region: 1039-1093
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000173
Family Laminin-type module 0.0019
Further Details:      
 
Domain Number 12 Region: 1096-1139
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000614
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 13 Region: 436-473
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000642
Family Laminin-type module 0.025
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000010772
Domain Number - Region: 1456-1666
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.011
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000010772   Gene: ENSLAFG00000012871   Transcript: ENSLAFT00000012882
Sequence length 1799
Comment pep:novel supercontig:loxAfr3:scaffold_12:18241027:18255093:1 gene:ENSLAFG00000012871 transcript:ENSLAFT00000012882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEWASGERRRGRWGQPVPWELRLGLLLSVLADALARAPDVPGCSRGSCYPATGDLLVGRA
DRLTASSTCGLRGPQPYCIVSHLQDEKKCFLCDSRRPFSAGDNPNSHRIQNVVTSFAPQR
RAAWWQSENGVPMVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGHTWHVYRYFS
YDCGADFPGVPLAPPRRWDDVICESRYSEIEPSTEGEVIYRVLDPAIPIPNPYSPRIQNL
LKITNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVVRGNCFCYGHASQCAPAPGAP
AHVEGMVHGACVCKHNTRGLNCEQCQDFYHDLPWHPAEDGHSHACRKCECHGHSHSCHFD
MAVYLASGNVSGGVCDACQHNTAGRHCELCRPFFYRDPTKDLRDPAVCRNCDCDPMGTQD
GGRCDSHDDPALGLVSGQCRCKEHVVGARCQQCRNGFFGLSASDPRGCRRCRCDARGTVS
GGNPCNPSSGTCFCKRLVTGRGCDHCLPGHWGLSHDLVGCRPCDCDIGGALDPQCDEASG
QCRCRQHMVGRRCEQVQPGYFRPFLDHLTWEAEDSRGQSLEVVERVATVEGTPSWTGPGF
VRLREGQVLEFLVASVPRAMDYDLLLRLEPQVPEQWAEMELTVQRPGPVSALSQCGHVLP
EDNRIRGTLRPDSRYTVFSSPVCLEPGISYTLRLELVRAGGGTQPGTPYSGPSLLIDSLV
LLPRVLVLEMFSGGDAAAMERHATFERYRCHEEGLAPSKTPPSEACAPLLISASTLLYNG
ALPCQCDPQGSLSSECSPHGGQCLCKPGVVGRRCDLCAPGYYGFGPMGCRACQCSPEGAL
SGLCEGTSGQCPCRTGAFGLRCDRCRRGQWGFPTCRPCVCNGHADECDTHTGACLSCRDH
TGGEHCERCIAGFHGDPRLPYGGQCRPCSCPEGPGSQRHFATSCHQDGYSQQVVCHCRPG
YTGPRCDACAPGHFGDPSRPGGRCQPCECSGNIDPMDPDACDPHTGQCLRCLHNTEGPHC
AHCKPGFHGQAARQSCHRCTCNQLGTDSQQCLSTNWCHCDPSTGQCPCLPNVQGLSCDRC
APNFWNLTSGRGCQPCACHPSRATGSTCNEFTGQCHCRAGFGGRTCSECQELHWGNPGLQ
CRACDCDPHGIDSPQCHRSTGHCSCRPGVSGVRCDQCARGFSGVFPACHPCHACFGDWDR
VVQDLAVRTRHLEQRARELQQTGVLGAFETSFWNIQEKLGTVQGIVGARNTSAASTARLV
EATEELRHEIGEATEHLTQLEAELTDVQDENFNANHALSGLERDGLALNLTLRQLSQHLD
LLKHSNFLGAYDSILHAHSQSSEAERRANTSALAVPSPVSNSADTRHQAEVLMGAQRANF
NRKHAANQRALGELSAHTNALSLTGLNELVCGAPGDAPCSTSPCGGAGCRDEDGQPRCGG
LSCNGAAAMADLALVRARHTQAELQRALAASGGILSQVAETRRQAGEAQQRAQAARDKAN
ATRGQVEQANQELRELIQSVKDFLSQEGADPDSIEMVATRVLELSIPASPDQIQHLAGEI
AERVRSLADVDTILARTVGDVRRAERLLQDARRARTRAESEKQKAETVQAALEETRRAQG
AAQGAIRGAAVDTRDTEQTLHQVRERMAGTEQALGSAGKRAQQLDALLEALKLKRAGNSL
AASQAEETAGSAQSRAQEAEQLLQGPLGDRYQRVRVLAERKAQGVLAAQVRAEQLRDEAW
GLLQAAQDKLQRLQELESTYEENERALEGKAAQLDGLEARMRSVLQAINLQVQIYNTCQ
Download sequence
Identical sequences G3TAA0
ENSLAFP00000010772 XP_003409714.1.64505 ENSLAFP00000010772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]