SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000010835 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000010835
Domain Number 1 Region: 9-173
Classification Level Classification E-value
Superfamily RUN domain-like 1.44e-48
Family RUN domain 0.000000154
Further Details:      
 
Domain Number 2 Region: 536-602
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.32e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000010835   Gene: ENSLAFG00000012964   Transcript: ENSLAFT00000012962
Sequence length 606
Comment pep:novel supercontig:loxAfr3:scaffold_10:49977741:50039636:-1 gene:ENSLAFG00000012964 transcript:ENSLAFT00000012962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SATKDPTAVERANLLNMAKLSIKGLIESALSFGRTLDSDYPPLQQFFVVMEHCLKHGLKV
RKSFLSYNKTIWGPLELVEKLYPEAEEIGASVRDLPGLKTPLGRARAWLRLALMQKKMAD
YLRCLIIQRDLLSEFYEYHALMMEEEGAVIVGLLVGLNVIDANLCVKGEDLDSQVGVIDF
SMYLKNEEDIGNKERNVQIAAILDQKNYVEELNRQLNNTVSSLHSRVDSLEKSNTKLIEE
LAIAKNNIIKLQEENHQLRSENKLILMKTQQHLEVTKVDVETELQTYKHSRQGLDEMYTE
ARRQLRDESQLRQDVENELTVQVSMKKEIELAMKLLEKDIHEKQDTLIGLRQQLEEVKAI
NIEMYQKLQGSEDGLKEKNEIIARLEEKTSNITAAMRQLEQRLQQAEKAQMEAEDEDEKY
LQECLSKSDSLQKQISQKEKQLVQLETDVKIEKEWRQTLQEDLQKEKDALCHLRNETQQI
IILKKKSLNLQDENQQLKKVCHDQEQALQELGNKLSESKLKIEDIKEANKALQGLVWLKD
KEATHCKLCEKEFSLSKRKHHCRNCGEIFCNACSDNELPLPSSPKPVRVCDSCHALLIQR
CSSNLP
Download sequence
Identical sequences G3TAF1
ENSLAFP00000010835 ENSLAFP00000010835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]